BLASTX nr result
ID: Sinomenium22_contig00042096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00042096 (666 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBA12000.1| putative auxin response factor 3 [Illicium parvi... 57 5e-06 ref|XP_002273401.2| PREDICTED: auxin response factor 3-like [Vit... 57 7e-06 emb|CBI30623.3| unnamed protein product [Vitis vinifera] 57 7e-06 ref|XP_007025523.1| Transcriptional factor B3 family protein / a... 56 9e-06 ref|XP_007025522.1| Transcriptional factor B3 family protein / a... 56 9e-06 ref|XP_007025521.1| Transcriptional factor B3 family protein / a... 56 9e-06 ref|XP_007025520.1| Transcriptional factor B3 family protein / a... 56 9e-06 ref|XP_007025519.1| Transcriptional factor B3 family protein / a... 56 9e-06 ref|XP_007025518.1| Transcriptional factor B3 family protein / a... 56 9e-06 emb|CAN65414.1| hypothetical protein VITISV_009739 [Vitis vinifera] 56 9e-06 >emb|CBA12000.1| putative auxin response factor 3 [Illicium parviflorum] Length = 837 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/33 (75%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +3 Query: 3 KDATER--SGLITGIGDMDPVMWPGSKWRCLLV 95 +DATE+ +GLITGIGD+DPV WPGSKWRCL+V Sbjct: 313 EDATEQRPTGLITGIGDIDPVRWPGSKWRCLMV 345 >ref|XP_002273401.2| PREDICTED: auxin response factor 3-like [Vitis vinifera] Length = 740 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/33 (78%), Positives = 28/33 (84%), Gaps = 2/33 (6%) Frame = +3 Query: 3 KDATER--SGLITGIGDMDPVMWPGSKWRCLLV 95 +DA ER +GLITGI DMDPV WPGSKWRCLLV Sbjct: 332 EDAAERRYTGLITGISDMDPVRWPGSKWRCLLV 364 >emb|CBI30623.3| unnamed protein product [Vitis vinifera] Length = 701 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/33 (78%), Positives = 28/33 (84%), Gaps = 2/33 (6%) Frame = +3 Query: 3 KDATER--SGLITGIGDMDPVMWPGSKWRCLLV 95 +DA ER +GLITGI DMDPV WPGSKWRCLLV Sbjct: 328 EDAAERRYTGLITGISDMDPVRWPGSKWRCLLV 360 >ref|XP_007025523.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 6, partial [Theobroma cacao] gi|508780889|gb|EOY28145.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 6, partial [Theobroma cacao] Length = 543 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/33 (75%), Positives = 28/33 (84%), Gaps = 2/33 (6%) Frame = +3 Query: 3 KDATER--SGLITGIGDMDPVMWPGSKWRCLLV 95 +DA ER +GL+TGI DMDPV WPGSKWRCLLV Sbjct: 129 EDAAERRYTGLVTGISDMDPVRWPGSKWRCLLV 161 >ref|XP_007025522.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 5, partial [Theobroma cacao] gi|508780888|gb|EOY28144.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 5, partial [Theobroma cacao] Length = 539 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/33 (75%), Positives = 28/33 (84%), Gaps = 2/33 (6%) Frame = +3 Query: 3 KDATER--SGLITGIGDMDPVMWPGSKWRCLLV 95 +DA ER +GL+TGI DMDPV WPGSKWRCLLV Sbjct: 129 EDAAERRYTGLVTGISDMDPVRWPGSKWRCLLV 161 >ref|XP_007025521.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 4 [Theobroma cacao] gi|508780887|gb|EOY28143.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 4 [Theobroma cacao] Length = 748 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/33 (75%), Positives = 28/33 (84%), Gaps = 2/33 (6%) Frame = +3 Query: 3 KDATER--SGLITGIGDMDPVMWPGSKWRCLLV 95 +DA ER +GL+TGI DMDPV WPGSKWRCLLV Sbjct: 334 EDAAERRYTGLVTGISDMDPVRWPGSKWRCLLV 366 >ref|XP_007025520.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 3 [Theobroma cacao] gi|508780886|gb|EOY28142.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 3 [Theobroma cacao] Length = 745 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/33 (75%), Positives = 28/33 (84%), Gaps = 2/33 (6%) Frame = +3 Query: 3 KDATER--SGLITGIGDMDPVMWPGSKWRCLLV 95 +DA ER +GL+TGI DMDPV WPGSKWRCLLV Sbjct: 335 EDAAERRYTGLVTGISDMDPVRWPGSKWRCLLV 367 >ref|XP_007025519.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 2 [Theobroma cacao] gi|508780885|gb|EOY28141.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 2 [Theobroma cacao] Length = 606 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/33 (75%), Positives = 28/33 (84%), Gaps = 2/33 (6%) Frame = +3 Query: 3 KDATER--SGLITGIGDMDPVMWPGSKWRCLLV 95 +DA ER +GL+TGI DMDPV WPGSKWRCLLV Sbjct: 192 EDAAERRYTGLVTGISDMDPVRWPGSKWRCLLV 224 >ref|XP_007025518.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 1 [Theobroma cacao] gi|508780884|gb|EOY28140.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related isoform 1 [Theobroma cacao] Length = 744 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/33 (75%), Positives = 28/33 (84%), Gaps = 2/33 (6%) Frame = +3 Query: 3 KDATER--SGLITGIGDMDPVMWPGSKWRCLLV 95 +DA ER +GL+TGI DMDPV WPGSKWRCLLV Sbjct: 334 EDAAERRYTGLVTGISDMDPVRWPGSKWRCLLV 366 >emb|CAN65414.1| hypothetical protein VITISV_009739 [Vitis vinifera] Length = 831 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 2/39 (5%) Frame = +3 Query: 3 KDATER--SGLITGIGDMDPVMWPGSKWRCLLVCDSWAS 113 +DA ER +GLITGI DMDPV WPGSKWRCLL+ S S Sbjct: 331 EDAAERRYTGLITGISDMDPVRWPGSKWRCLLLHHSHGS 369