BLASTX nr result
ID: Sinomenium22_contig00040434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00040434 (536 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB36696.1| hypothetical protein L484_016947 [Morus notabilis] 56 5e-06 emb|CAN60246.1| hypothetical protein VITISV_015672 [Vitis vinifera] 56 6e-06 ref|XP_007029805.1| Uncharacterized protein TCM_025680 [Theobrom... 55 8e-06 >gb|EXB36696.1| hypothetical protein L484_016947 [Morus notabilis] Length = 160 Score = 56.2 bits (134), Expect = 5e-06 Identities = 19/32 (59%), Positives = 25/32 (78%) Frame = +2 Query: 2 ESQTAPWYPVAGMVLVGIPWLFWLLTFTYSCF 97 E+Q++ WYP+AGM+LV +PW FW TF Y CF Sbjct: 36 ETQSSAWYPIAGMILVSVPWAFWFFTFLYRCF 67 >emb|CAN60246.1| hypothetical protein VITISV_015672 [Vitis vinifera] Length = 144 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +2 Query: 5 SQTAPWYPVAGMVLVGIPWLFWLLTFTYSCF 97 +Q WYP+ G +LVGIPWLFWLLT+ Y CF Sbjct: 37 AQHTSWYPIVGFILVGIPWLFWLLTYCYRCF 67 >ref|XP_007029805.1| Uncharacterized protein TCM_025680 [Theobroma cacao] gi|508718410|gb|EOY10307.1| Uncharacterized protein TCM_025680 [Theobroma cacao] Length = 243 Score = 55.5 bits (132), Expect = 8e-06 Identities = 18/34 (52%), Positives = 28/34 (82%) Frame = +2 Query: 2 ESQTAPWYPVAGMVLVGIPWLFWLLTFTYSCFSF 103 + ++APWYPVAG++LVGIPW+FW+ + Y C ++ Sbjct: 88 DEESAPWYPVAGIILVGIPWIFWIGAYAYRCCAY 121