BLASTX nr result
ID: Sinomenium22_contig00040173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00040173 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524519.1| Peptide-N4-(N-acetyl-beta-glucosaminyl)aspar... 58 1e-06 >ref|XP_002524519.1| Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A, putative [Ricinus communis] gi|223536193|gb|EEF37846.1| Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A, putative [Ricinus communis] Length = 624 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = -2 Query: 310 CYFRNVSSSNYTVIYDKSGDPCNDTQKTRSTHGSAGRRPFSARRASLAFDL 158 CYFRNVSSSNYT++YDK G+ CN +++ G + P RRASLA +L Sbjct: 568 CYFRNVSSSNYTILYDKVGNKCNKKEQSHLGFGLSRWWPLPTRRASLASEL 618