BLASTX nr result
ID: Sinomenium22_contig00039299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00039299 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC29927.1| hypothetical protein L484_015120 [Morus notabilis] 57 2e-06 >gb|EXC29927.1| hypothetical protein L484_015120 [Morus notabilis] Length = 382 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = +3 Query: 198 MKSSNFFSLLAESKSRRSXXXXXXXXXXXXXXVFFTGTAFIGTEYKEKLSRWDVTGTLQD 377 MK S F SLL +S SRRS V+F G+AFI +YKEKLS W VT TLQ+ Sbjct: 1 MKPSYFLSLLVDSHSRRSCFCSLIPAASLLCLVYFIGSAFIAPDYKEKLSLWGVTDTLQN 60 Query: 378 TKSISLTCKGQ 410 K CK Q Sbjct: 61 FKLNK--CKNQ 69