BLASTX nr result
ID: Sinomenium22_contig00039006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00039006 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006593371.1| PREDICTED: uncharacterized protein LOC100500... 97 2e-18 ref|XP_007018018.1| Nucleotide-diphospho-sugar transferases supe... 97 2e-18 ref|XP_003529363.1| PREDICTED: dolichol-phosphate mannosyltransf... 97 2e-18 ref|XP_002300644.1| dolichyl-phosphate beta-D-mannosyltransferas... 97 2e-18 gb|EYU30278.1| hypothetical protein MIMGU_mgv1a012434mg [Mimulus... 97 3e-18 ref|XP_002510671.1| dolichol-phosphate mannosyltransferase, puta... 97 3e-18 ref|XP_004309507.1| PREDICTED: dolichol-phosphate mannosyltransf... 96 4e-18 gb|AFK46115.1| unknown [Medicago truncatula] 96 5e-18 ref|XP_007153703.1| hypothetical protein PHAVU_003G057700g [Phas... 96 7e-18 ref|XP_007209485.1| hypothetical protein PRUPE_ppa010139mg [Prun... 95 1e-17 gb|AFK34133.1| unknown [Lotus japonicus] 95 1e-17 gb|EXB56325.1| hypothetical protein L484_024867 [Morus notabilis] 94 2e-17 ref|XP_003597358.1| Dolichol-phosphate mannosyltransferase [Medi... 94 2e-17 ref|XP_002307788.1| dolichyl-phosphate beta-D-mannosyltransferas... 94 2e-17 ref|XP_006473777.1| PREDICTED: dolichol-phosphate mannosyltransf... 93 4e-17 ref|XP_006435349.1| hypothetical protein CICLE_v10003501mg, part... 93 4e-17 ref|XP_004505127.1| PREDICTED: dolichol-phosphate mannosyltransf... 93 4e-17 ref|XP_004145537.1| PREDICTED: dolichol-phosphate mannosyltransf... 93 4e-17 ref|XP_006841444.1| hypothetical protein AMTR_s00003p00074710 [A... 92 6e-17 gb|EPS70936.1| hypothetical protein M569_03823, partial [Genlise... 92 6e-17 >ref|XP_006593371.1| PREDICTED: uncharacterized protein LOC100500321 isoform X1 [Glycine max] gi|571495780|ref|XP_006593372.1| PREDICTED: uncharacterized protein LOC100500321 isoform X2 [Glycine max] Length = 243 Score = 97.1 bits (240), Expect = 2e-18 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRASRKGYHIEEVPITFVDRV+GSSKLGGSEIVEYLKGLAYLLV T Sbjct: 194 MEMIVRASRKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT 243 >ref|XP_007018018.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma cacao] gi|508723346|gb|EOY15243.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma cacao] Length = 241 Score = 97.1 bits (240), Expect = 2e-18 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRASRKGYHIEEVPITFVDRV+GSSKLGGSEIVEYLKGLAYLLV T Sbjct: 192 MEMIVRASRKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT 241 >ref|XP_003529363.1| PREDICTED: dolichol-phosphate mannosyltransferase-like isoform X1 [Glycine max] gi|571467119|ref|XP_006583843.1| PREDICTED: dolichol-phosphate mannosyltransferase-like isoform X2 [Glycine max] Length = 243 Score = 97.1 bits (240), Expect = 2e-18 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRASRKGYHIEEVPITFVDRV+GSSKLGGSEIVEYLKGLAYLLV T Sbjct: 194 MEMIVRASRKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT 243 >ref|XP_002300644.1| dolichyl-phosphate beta-D-mannosyltransferase family protein [Populus trichocarpa] gi|222842370|gb|EEE79917.1| dolichyl-phosphate beta-D-mannosyltransferase family protein [Populus trichocarpa] Length = 240 Score = 97.1 bits (240), Expect = 2e-18 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRASRKGYHIEEVPITFVDRV+GSSKLGGSEIVEYLKGLAYLLV T Sbjct: 191 MEMIVRASRKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT 240 >gb|EYU30278.1| hypothetical protein MIMGU_mgv1a012434mg [Mimulus guttatus] Length = 250 Score = 96.7 bits (239), Expect = 3e-18 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGL YLLV T Sbjct: 201 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLLYLLVTT 250 >ref|XP_002510671.1| dolichol-phosphate mannosyltransferase, putative [Ricinus communis] gi|223551372|gb|EEF52858.1| dolichol-phosphate mannosyltransferase, putative [Ricinus communis] Length = 238 Score = 96.7 bits (239), Expect = 3e-18 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRASRKGYHIEEVPITF+DRV+GSSKLGGSEIVEYLKGLAYLLV T Sbjct: 189 MEMIVRASRKGYHIEEVPITFIDRVFGSSKLGGSEIVEYLKGLAYLLVTT 238 >ref|XP_004309507.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Fragaria vesca subsp. vesca] Length = 239 Score = 96.3 bits (238), Expect = 4e-18 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRASRKGYHIEEVPITFVDRVYG SKLGGSEIVEYLKGLAYLLV T Sbjct: 190 MEMIVRASRKGYHIEEVPITFVDRVYGISKLGGSEIVEYLKGLAYLLVTT 239 >gb|AFK46115.1| unknown [Medicago truncatula] Length = 243 Score = 95.9 bits (237), Expect = 5e-18 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGL YLL+ T Sbjct: 194 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLLMTT 243 >ref|XP_007153703.1| hypothetical protein PHAVU_003G057700g [Phaseolus vulgaris] gi|561027057|gb|ESW25697.1| hypothetical protein PHAVU_003G057700g [Phaseolus vulgaris] Length = 243 Score = 95.5 bits (236), Expect = 7e-18 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRASRKGYHI+EVPITFVDRV+GSSKLGGSEIVEYLKGLAYLLV T Sbjct: 194 MEMIVRASRKGYHIKEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT 243 >ref|XP_007209485.1| hypothetical protein PRUPE_ppa010139mg [Prunus persica] gi|462405220|gb|EMJ10684.1| hypothetical protein PRUPE_ppa010139mg [Prunus persica] Length = 262 Score = 94.7 bits (234), Expect = 1e-17 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRASRKGYHIEEVPI+FVDRVYG SKLGGSEIVEYLKGLAYLLV T Sbjct: 188 MEMIVRASRKGYHIEEVPISFVDRVYGISKLGGSEIVEYLKGLAYLLVTT 237 >gb|AFK34133.1| unknown [Lotus japonicus] Length = 243 Score = 94.7 bits (234), Expect = 1e-17 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIV+YLKG+ YLLV T Sbjct: 194 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVQYLKGVVYLLVTT 243 >gb|EXB56325.1| hypothetical protein L484_024867 [Morus notabilis] Length = 244 Score = 94.4 bits (233), Expect = 2e-17 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRASRKGY IEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLV T Sbjct: 195 MEMIVRASRKGYLIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVTT 244 >ref|XP_003597358.1| Dolichol-phosphate mannosyltransferase [Medicago truncatula] gi|355486406|gb|AES67609.1| Dolichol-phosphate mannosyltransferase [Medicago truncatula] Length = 271 Score = 94.4 bits (233), Expect = 2e-17 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRASRKGYHI+EVPITFVDRVYGSSKLGGSEIVEYLKGL YLL+ T Sbjct: 222 MEMIVRASRKGYHIKEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLLMTT 271 >ref|XP_002307788.1| dolichyl-phosphate beta-D-mannosyltransferase family protein [Populus trichocarpa] gi|222857237|gb|EEE94784.1| dolichyl-phosphate beta-D-mannosyltransferase family protein [Populus trichocarpa] Length = 238 Score = 94.0 bits (232), Expect = 2e-17 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRASRKGY IEEVPITFVDRV+GSSKLGGSEIVEYLKGLAYLLV T Sbjct: 189 MEMIVRASRKGYQIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT 238 >ref|XP_006473777.1| PREDICTED: dolichol-phosphate mannosyltransferase-like isoform X1 [Citrus sinensis] Length = 242 Score = 92.8 bits (229), Expect = 4e-17 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRA RKGYHIEEVPITFVDRV+GSSKLGGSEIVEYLKGL YLL+ T Sbjct: 193 MEMIVRACRKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLLYLLITT 242 >ref|XP_006435349.1| hypothetical protein CICLE_v10003501mg, partial [Citrus clementina] gi|557537471|gb|ESR48589.1| hypothetical protein CICLE_v10003501mg, partial [Citrus clementina] Length = 245 Score = 92.8 bits (229), Expect = 4e-17 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRA RKGYHIEEVPITFVDRV+GSSKLGGSEIVEYLKGL YLL+ T Sbjct: 196 MEMIVRACRKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLLYLLITT 245 >ref|XP_004505127.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Cicer arietinum] Length = 242 Score = 92.8 bits (229), Expect = 4e-17 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRASRKGY IEEVPITFVDRVYGSSKLGGSEIVEYLKGL YLL+ T Sbjct: 193 MEMIVRASRKGYRIEEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLLMTT 242 >ref|XP_004145537.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Cucumis sativus] gi|449512678|ref|XP_004164113.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Cucumis sativus] Length = 242 Score = 92.8 bits (229), Expect = 4e-17 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVRA+RKGYHIEEVPITFVDRV+G+SKLGGSEIVEYLKGL YLLV T Sbjct: 193 MEMIVRATRKGYHIEEVPITFVDRVFGTSKLGGSEIVEYLKGLLYLLVTT 242 >ref|XP_006841444.1| hypothetical protein AMTR_s00003p00074710 [Amborella trichopoda] gi|548843465|gb|ERN03119.1| hypothetical protein AMTR_s00003p00074710 [Amborella trichopoda] Length = 246 Score = 92.4 bits (228), Expect = 6e-17 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 MEMIVR SRKGYHIEEVPITFVDRV+GSSKLGGSEIVEYLKGL YLL+ T Sbjct: 197 MEMIVRLSRKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLVYLLLTT 246 >gb|EPS70936.1| hypothetical protein M569_03823, partial [Genlisea aurea] Length = 238 Score = 92.4 bits (228), Expect = 6e-17 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = -2 Query: 272 MEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLAYLLVAT 123 ME+IVRASRKGYHIEEVPITFVDRV+GSSKLGGSEIVEYLKGL YLL+ T Sbjct: 189 MEIIVRASRKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLIYLLLTT 238