BLASTX nr result
ID: Sinomenium22_contig00038950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00038950 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006590934.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE... 55 8e-06 >ref|XP_006590934.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Glycine max] Length = 675 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/58 (44%), Positives = 37/58 (63%) Frame = +3 Query: 141 PKQGMEFDSTEDVLEFYKKYAQ*IGFGIKIRGSWRDDDGIIYRYILSCVREGRFEPSS 314 P GM F S E V FY++YA +GFG K+R S + DG ++ +IL+C REG P++ Sbjct: 46 PASGMSFPSKEAVKSFYRQYASRMGFGSKVRNSKKGRDGKLHYFILTCSREGTRVPNT 103