BLASTX nr result
ID: Sinomenium22_contig00038755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00038755 (533 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007206441.1| hypothetical protein PRUPE_ppa000754mg [Prun... 42 2e-06 >ref|XP_007206441.1| hypothetical protein PRUPE_ppa000754mg [Prunus persica] gi|462402083|gb|EMJ07640.1| hypothetical protein PRUPE_ppa000754mg [Prunus persica] Length = 1014 Score = 41.6 bits (96), Expect(3) = 2e-06 Identities = 25/58 (43%), Positives = 34/58 (58%) Frame = +2 Query: 2 GNSLLIFXXXXXXXKDVTESTWRGKPRSHMRSAIRAALIASFVGGDAVIALLAILVYY 175 GNSLL F K V +T R + R ++AIR +LIA VGG AV+ L +++YY Sbjct: 537 GNSLLKFPHSLSSPKGVLNNTSR-EHRPLKKAAIRISLIAGLVGGAAVLVLSCMMIYY 593 Score = 31.2 bits (69), Expect(3) = 2e-06 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +1 Query: 211 SSNKSTERKGIPQGDSSLSHMPVP 282 SS ++T +K + QGDS+LSH VP Sbjct: 602 SSKENTGKKAVEQGDSALSHRSVP 625 Score = 23.5 bits (49), Expect(3) = 2e-06 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 321 QDHLLSLEMKPICERGNTSAVLKGPTIVSLPEPATKD 431 QD S + + + +TS+VLK P + LPE K+ Sbjct: 636 QDLSPSSQTRSPHDASDTSSVLKKPKNLGLPESTKKE 672