BLASTX nr result
ID: Sinomenium22_contig00038686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00038686 (374 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD00325.1| hypothetical protein BAUCODRAFT_30808 [Baudoinia ... 93 3e-17 gb|EME40307.1| hypothetical protein DOTSEDRAFT_74940 [Dothistrom... 91 2e-16 gb|EME40270.1| hypothetical protein DOTSEDRAFT_28174 [Dothistrom... 80 4e-13 ref|XP_002479867.1| conserved hypothetical protein [Talaromyces ... 80 4e-13 gb|EXJ85742.1| hypothetical protein A1O1_06110 [Capronia coronat... 79 5e-13 dbj|GAA90217.1| similar to An09g01230 [Aspergillus kawachii IFO ... 77 3e-12 ref|XP_002143544.1| conserved hypothetical protein [Talaromyces ... 77 3e-12 ref|XP_001393441.1| hypothetical protein ANI_1_124084 [Aspergill... 77 3e-12 gb|EPS27160.1| hypothetical protein PDE_02103 [Penicillium oxali... 76 5e-12 gb|EHY54480.1| hypothetical protein HMPREF1120_02648 [Exophiala ... 73 4e-11 gb|EOA84030.1| hypothetical protein SETTUDRAFT_164344 [Setosphae... 72 6e-11 gb|ETI29517.1| hypothetical protein G647_01970 [Cladophialophora... 72 1e-10 ref|XP_001262998.1| hypothetical protein NFIA_062620 [Neosartory... 72 1e-10 gb|EXJ59648.1| hypothetical protein A1O7_03794 [Cladophialophora... 71 1e-10 gb|EMF08990.1| hypothetical protein SEPMUDRAFT_151862 [Sphaeruli... 71 2e-10 ref|XP_003190609.1| hypothetical protein AOR_1_240074 [Aspergill... 71 2e-10 ref|XP_002381810.1| conserved hypothetical protein [Aspergillus ... 70 2e-10 ref|XP_001271417.1| conserved hypothetical protein [Aspergillus ... 70 3e-10 gb|EMD96701.1| hypothetical protein COCHEDRAFT_1018530 [Bipolari... 69 7e-10 ref|XP_003299390.1| hypothetical protein PTT_10366 [Pyrenophora ... 69 9e-10 >gb|EMD00325.1| hypothetical protein BAUCODRAFT_30808 [Baudoinia compniacensis UAMH 10762] Length = 68 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/57 (75%), Positives = 50/57 (87%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 EDYLDKGLD E+ G++SGHN+DSTKMR TNEKITDKAR +FEK TGK+VP+KFSN Sbjct: 12 EDYLDKGLDAIEKKVGQQSGHNMDSTKMRGTNEKITDKARDMFEKATGKNVPDKFSN 68 >gb|EME40307.1| hypothetical protein DOTSEDRAFT_74940 [Dothistroma septosporum NZE10] Length = 65 Score = 90.9 bits (224), Expect = 2e-16 Identities = 42/57 (73%), Positives = 47/57 (82%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 EDYLDKGLD E+ FGKKSGHN+D K R+TNEKITDKAR + EK+TGK PEKFSN Sbjct: 9 EDYLDKGLDAVEKQFGKKSGHNIDPAKARSTNEKITDKAREMGEKLTGKKAPEKFSN 65 >gb|EME40270.1| hypothetical protein DOTSEDRAFT_28174 [Dothistroma septosporum NZE10] Length = 72 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/57 (64%), Positives = 41/57 (71%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 EDYLDK +D E+ FG+ SGH +D K R NEK TDK RG FEK TGK VPEKFSN Sbjct: 16 EDYLDKAVDAMEKKFGQASGHQIDPAKYRAQNEKFTDKLRGFFEKKTGKKVPEKFSN 72 >ref|XP_002479867.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218720014|gb|EED19433.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 75 Score = 79.7 bits (195), Expect = 4e-13 Identities = 39/57 (68%), Positives = 46/57 (80%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 EDYLDKGLD AE+ +G+ +D KMR+TNEKITD AR +FEK+TGKHVPEKFSN Sbjct: 22 EDYLDKGLDFAEKKYGQGK---IDPVKMRDTNEKITDGARNLFEKVTGKHVPEKFSN 75 >gb|EXJ85742.1| hypothetical protein A1O1_06110 [Capronia coronata CBS 617.96] Length = 67 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/57 (68%), Positives = 46/57 (80%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 EDYLDKGLD AE+ FG+ VD TK R+TNEKITDKAR +FEK TGK++P+KFSN Sbjct: 14 EDYLDKGLDAAEKKFGQGK---VDPTKQRSTNEKITDKARDLFEKTTGKNIPDKFSN 67 >dbj|GAA90217.1| similar to An09g01230 [Aspergillus kawachii IFO 4308] Length = 86 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/57 (68%), Positives = 41/57 (71%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 EDYLDKGLD EQ FG G +D KMR+TNEKITD AR FE TGK VPEKFSN Sbjct: 33 EDYLDKGLDSVEQKFG---GGKIDPQKMRSTNEKITDTARNQFESATGKKVPEKFSN 86 >ref|XP_002143544.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224] gi|210072942|gb|EEA27029.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224] Length = 73 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/57 (68%), Positives = 43/57 (75%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 EDYLDKGLD E FG+ +D KMR+TNEKITD ARG+FEK TGK VPEKFSN Sbjct: 20 EDYLDKGLDFIETKFGQGK---IDPVKMRDTNEKITDGARGMFEKFTGKKVPEKFSN 73 >ref|XP_001393441.1| hypothetical protein ANI_1_124084 [Aspergillus niger CBS 513.88] gi|134077980|emb|CAK49045.1| unnamed protein product [Aspergillus niger] Length = 86 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/57 (68%), Positives = 41/57 (71%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 EDYLDKGLD EQ FG G +D KMR+TNEKITD AR FE TGK VPEKFSN Sbjct: 33 EDYLDKGLDSVEQKFG---GGKIDPQKMRSTNEKITDTARNQFESATGKKVPEKFSN 86 >gb|EPS27160.1| hypothetical protein PDE_02103 [Penicillium oxalicum 114-2] Length = 81 Score = 75.9 bits (185), Expect = 5e-12 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 EDYLDK LD AE+ +G G +VD KMR+TNEKITD R FE TGKHVPEKFSN Sbjct: 28 EDYLDKALDSAERKYG---GGHVDPAKMRSTNEKITDGVRNQFESATGKHVPEKFSN 81 >gb|EHY54480.1| hypothetical protein HMPREF1120_02648 [Exophiala dermatitidis NIH/UT8656] Length = 67 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/57 (61%), Positives = 42/57 (73%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 EDYLDKGLD E+ +G G +D K R+TNEKITDKARG+ EK TGK +P+K SN Sbjct: 14 EDYLDKGLDAVEKKYG---GGKIDPAKQRSTNEKITDKARGLVEKATGKDIPDKISN 67 >gb|EOA84030.1| hypothetical protein SETTUDRAFT_164344 [Setosphaeria turcica Et28A] Length = 68 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/57 (64%), Positives = 41/57 (71%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 EDYLDKGLD AE+ +G G D+ K R NEKITD AR +FEK TGKHVPEK SN Sbjct: 14 EDYLDKGLDAAEKKYGGSMGQ--DTQKNRAINEKITDGARNMFEKATGKHVPEKISN 68 >gb|ETI29517.1| hypothetical protein G647_01970 [Cladophialophora carrionii CBS 160.54] Length = 66 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/57 (63%), Positives = 42/57 (73%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 EDYLDKGLD AE+ FG+ VD K R+ NEK+TDKAR +FEK TGK VP+K SN Sbjct: 13 EDYLDKGLDAAEKRFGQGK---VDPAKSRSVNEKVTDKARDMFEKATGKDVPDKVSN 66 >ref|XP_001262998.1| hypothetical protein NFIA_062620 [Neosartorya fischeri NRRL 181] gi|119411158|gb|EAW21101.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181] Length = 84 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/57 (63%), Positives = 42/57 (73%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 ED++D+GLD EQ FG G +D+ KMR+TNEKITD AR FEK TG VPEKFSN Sbjct: 31 EDFVDRGLDALEQRFG---GGKIDTAKMRSTNEKITDAAREQFEKATGYKVPEKFSN 84 >gb|EXJ59648.1| hypothetical protein A1O7_03794 [Cladophialophora yegresii CBS 114405] Length = 66 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/57 (61%), Positives = 42/57 (73%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 EDYLDKGLD AE+ FG+ +D K R+ NEK+TDKAR +FEK TGK VP+K SN Sbjct: 13 EDYLDKGLDAAEKRFGQGK---IDPAKSRSVNEKVTDKARDMFEKATGKDVPDKVSN 66 >gb|EMF08990.1| hypothetical protein SEPMUDRAFT_151862 [Sphaerulina musiva SO2202] Length = 72 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/57 (59%), Positives = 38/57 (66%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 EDYLDK +D E+ G SG NVD K R NEK+TDK RG EK TGK +P KFSN Sbjct: 16 EDYLDKAVDAVEKKLGGMSGKNVDPQKYRAQNEKLTDKIRGFLEKATGKKMPSKFSN 72 >ref|XP_003190609.1| hypothetical protein AOR_1_240074 [Aspergillus oryzae RIB40] Length = 80 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/57 (61%), Positives = 40/57 (70%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 +DY+DKGLD E+ FG N D K+R TNEK TD AR FE MTGKH+PEKFSN Sbjct: 25 KDYVDKGLDSIEKKFGG-GRINPDDPKVRQTNEKFTDGARSKFESMTGKHIPEKFSN 80 >ref|XP_002381810.1| conserved hypothetical protein [Aspergillus flavus NRRL3357] gi|220692047|gb|EED48394.1| conserved hypothetical protein [Aspergillus flavus NRRL3357] Length = 80 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/56 (62%), Positives = 39/56 (69%) Frame = +1 Query: 103 DYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 DY+DKGLD E+ FG N D K+R TNEK TD AR FE MTGKH+PEKFSN Sbjct: 26 DYVDKGLDSIEKKFGG-GRINPDDPKVRQTNEKFTDGARSKFESMTGKHIPEKFSN 80 >ref|XP_001271417.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] gi|119399563|gb|EAW09991.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] Length = 100 Score = 70.1 bits (170), Expect = 3e-10 Identities = 37/57 (64%), Positives = 39/57 (68%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 EDYLD+GLD E+ FG G VD KMR TNEKITD R FEK TG VPEKFSN Sbjct: 47 EDYLDRGLDALERKFG---GGKVDPVKMRATNEKITDGVRAQFEKATGYKVPEKFSN 100 >gb|EMD96701.1| hypothetical protein COCHEDRAFT_1018530 [Bipolaris maydis C5] gi|477586484|gb|ENI03568.1| hypothetical protein COCC4DRAFT_32844 [Bipolaris maydis ATCC 48331] Length = 75 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/57 (59%), Positives = 41/57 (71%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 EDYLDKGLD E+ +G + D+ K R NEKITD AR +FEK TGK+VP+KFSN Sbjct: 21 EDYLDKGLDAVEKKYGGATAE--DTQKYRGVNEKITDGARNMFEKATGKNVPDKFSN 75 >ref|XP_003299390.1| hypothetical protein PTT_10366 [Pyrenophora teres f. teres 0-1] gi|311326973|gb|EFQ92526.1| hypothetical protein PTT_10366 [Pyrenophora teres f. teres 0-1] Length = 84 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/57 (59%), Positives = 41/57 (71%) Frame = +1 Query: 100 EDYLDKGLDKAEQMFGKKSGHNVDSTKMRNTNEKITDKARGVFEKMTGKHVPEKFSN 270 EDYLDKGLD AE+ +G +G D+ K R NEKITD AR +FEK TGK +P+K SN Sbjct: 30 EDYLDKGLDAAEKKWGGAAGQ--DTEKNRGVNEKITDTARNMFEKATGKDIPDKISN 84