BLASTX nr result
ID: Sinomenium22_contig00038456
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00038456 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280289.2| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 emb|CBI15077.3| unnamed protein product [Vitis vinifera] 77 2e-12 ref|XP_002280276.2| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 gb|EXC31176.1| hypothetical protein L484_004942 [Morus notabilis] 62 1e-07 ref|XP_004236513.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_006345185.1| PREDICTED: pentatricopeptide repeat-containi... 55 1e-05 >ref|XP_002280289.2| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 663 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/74 (52%), Positives = 52/74 (70%) Frame = +1 Query: 121 TLIQLLKQCPELSQIKSIHAQLITQNHSSNPSLLAALIRSYITCNNLNYAQILLFDHSPS 300 T +QLLK+ P L+QIK IHAQ++T + N SLL LI SYI C NL++A+I +FD PS Sbjct: 57 TFVQLLKKRPSLTQIKQIHAQVVTHGLAQNTSLLGPLIHSYIGCRNLSFARI-VFDQFPS 115 Query: 301 FPSPLLLNQIIQAY 342 P ++ N +IQAY Sbjct: 116 LPPTIIWNLMIQAY 129 >emb|CBI15077.3| unnamed protein product [Vitis vinifera] Length = 804 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/74 (52%), Positives = 52/74 (70%) Frame = +1 Query: 121 TLIQLLKQCPELSQIKSIHAQLITQNHSSNPSLLAALIRSYITCNNLNYAQILLFDHSPS 300 T +QLLK+ P L+QIK IHAQ++T + N SLL LI SYI C NL++A+I +FD PS Sbjct: 57 TFVQLLKKRPSLTQIKQIHAQVVTHGLAQNTSLLGPLIHSYIGCRNLSFARI-VFDQFPS 115 Query: 301 FPSPLLLNQIIQAY 342 P ++ N +IQAY Sbjct: 116 LPPTIIWNLMIQAY 129 >ref|XP_002280276.2| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Vitis vinifera] Length = 684 Score = 63.2 bits (152), Expect = 4e-08 Identities = 40/79 (50%), Positives = 51/79 (64%), Gaps = 2/79 (2%) Frame = +1 Query: 112 NPKTLIQLLKQCPELSQIKSIHAQLITQNHSSNPSLLAALIRSYITCNNLNYAQILLFDH 291 NP+T LL Q P+LS ++ IHAQ++TQ SSN SL A+LI Y+ N A+I LFDH Sbjct: 73 NPQTFSLLLNQRPKLSPLQQIHAQVVTQALSSNASLTASLIHCYLCAKNHPNARI-LFDH 131 Query: 292 SPSFPSP--LLLNQIIQAY 342 PS PSP L N +I+ Y Sbjct: 132 YPS-PSPPIKLWNVMIRTY 149 >gb|EXC31176.1| hypothetical protein L484_004942 [Morus notabilis] Length = 660 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/76 (43%), Positives = 48/76 (63%) Frame = +1 Query: 115 PKTLIQLLKQCPELSQIKSIHAQLITQNHSSNPSLLAALIRSYITCNNLNYAQILLFDHS 294 P+TL QLLK+ P L +K IHA+++T SS+ SL +LI Y+ +LN A+IL + Sbjct: 47 PQTLFQLLKKGPSLPNLKQIHAKVVTFALSSHASLTTSLINCYLCIKDLNKARILFDRYP 106 Query: 295 PSFPSPLLLNQIIQAY 342 S P L+ N +I+AY Sbjct: 107 SSLPPTLVWNLMIRAY 122 >ref|XP_004236513.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Solanum lycopersicum] Length = 618 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/76 (40%), Positives = 44/76 (57%) Frame = +1 Query: 118 KTLIQLLKQCPELSQIKSIHAQLITQNHSSNPSLLAALIRSYITCNNLNYAQILLFDHSP 297 K L +LL Q P SQ+K IHAQ++TQ SS S++ +LI Y+ + A+ L H Sbjct: 42 KELCKLLHQRPPKSQLKQIHAQILTQELSSTASIVNSLIHCYLHIKEVTSARFLFLHHPL 101 Query: 298 SFPSPLLLNQIIQAYC 345 S P L+ N +I+ YC Sbjct: 102 SSPPILIWNLMIRVYC 117 >ref|XP_006345185.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Solanum tuberosum] Length = 547 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/76 (39%), Positives = 43/76 (56%) Frame = +1 Query: 118 KTLIQLLKQCPELSQIKSIHAQLITQNHSSNPSLLAALIRSYITCNNLNYAQILLFDHSP 297 K L +LL Q P SQ+K IHAQ++TQ SS SL+ +LI Y+ + A+ L + Sbjct: 31 KELSKLLHQRPPKSQLKQIHAQILTQELSSTASLVNSLIHCYLHIKEVTSARFLFLHYPL 90 Query: 298 SFPSPLLLNQIIQAYC 345 P L+ N +I+ YC Sbjct: 91 PSPPILIWNLMIRVYC 106