BLASTX nr result
ID: Sinomenium22_contig00038364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00038364 (450 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006369469.1| hypothetical protein POPTR_0001s23730g [Popu... 59 7e-07 >ref|XP_006369469.1| hypothetical protein POPTR_0001s23730g [Populus trichocarpa] gi|550348018|gb|ERP66038.1| hypothetical protein POPTR_0001s23730g [Populus trichocarpa] Length = 127 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/71 (45%), Positives = 44/71 (61%), Gaps = 4/71 (5%) Frame = +1 Query: 163 MDPMTQNMKKKITKPANMVRKGGPWEPPLSL-PPNFCSAMSPSLGL---ANILGTLRVSC 330 +DP TQ+ ++K PA +VR GGPW L + PP+F S SPS GL AN + L ++C Sbjct: 3 IDPKTQHKREKTRNPAKIVRNGGPWASSLDIVPPDFSSLESPSEGLEFEANTVYNLVLNC 62 Query: 331 DLSTFTNLKLK 363 +L+ F NL K Sbjct: 63 NLAAFLNLDPK 73