BLASTX nr result
ID: Sinomenium22_contig00038254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00038254 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006833311.1| hypothetical protein AMTR_s00109p00051840 [A... 86 5e-15 ref|XP_004503444.1| PREDICTED: uncharacterized protein LOC101498... 86 5e-15 gb|EYU29802.1| hypothetical protein MIMGU_mgv1a011711mg [Mimulus... 86 7e-15 gb|EYU29801.1| hypothetical protein MIMGU_mgv1a011711mg [Mimulus... 86 7e-15 ref|XP_006381720.1| hypothetical protein POPTR_0006s16320g [Popu... 85 1e-14 ref|XP_004503445.1| PREDICTED: uncharacterized protein LOC101498... 84 2e-14 ref|XP_002284354.1| PREDICTED: uncharacterized protein LOC100262... 84 2e-14 ref|XP_007152852.1| hypothetical protein PHAVU_004G165400g [Phas... 84 2e-14 ref|XP_007013145.1| Uncharacterized protein isoform 1 [Theobroma... 84 2e-14 ref|XP_006298341.1| hypothetical protein CARUB_v10014410mg [Caps... 84 3e-14 ref|XP_006298340.1| hypothetical protein CARUB_v10014410mg [Caps... 84 3e-14 ref|XP_003534206.1| PREDICTED: uncharacterized protein LOC100800... 84 3e-14 ref|NP_001238243.1| uncharacterized protein LOC100305375 [Glycin... 84 3e-14 ref|XP_006451180.1| hypothetical protein CICLE_v10009216mg [Citr... 83 3e-14 ref|XP_007202457.1| hypothetical protein PRUPE_ppa010091mg [Prun... 83 3e-14 ref|XP_006654686.1| PREDICTED: uncharacterized protein LOC102716... 83 4e-14 ref|XP_003630785.1| Cov1 [Medicago truncatula] gi|355524807|gb|A... 83 4e-14 ref|XP_002441424.1| hypothetical protein SORBIDRAFT_09g026360 [S... 83 4e-14 gb|EEC79568.1| hypothetical protein OsI_20718 [Oryza sativa Indi... 83 4e-14 ref|NP_001132324.1| hypothetical protein [Zea mays] gi|194694080... 83 4e-14 >ref|XP_006833311.1| hypothetical protein AMTR_s00109p00051840 [Amborella trichopoda] gi|548837987|gb|ERM98589.1| hypothetical protein AMTR_s00109p00051840 [Amborella trichopoda] Length = 269 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLDARA 140 LYIGDIFLINS DVIRPNLSVREGIEIVVSGGMSMPQILSTLD++A Sbjct: 213 LYIGDIFLINSNDVIRPNLSVREGIEIVVSGGMSMPQILSTLDSQA 258 >ref|XP_004503444.1| PREDICTED: uncharacterized protein LOC101498085 [Cicer arietinum] Length = 265 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLDARAT 143 LYIGDIFL+N++DVIRP LSVREGIEIVVSGGMSMPQILSTLD+RAT Sbjct: 210 LYIGDIFLVNTKDVIRPTLSVREGIEIVVSGGMSMPQILSTLDSRAT 256 >gb|EYU29802.1| hypothetical protein MIMGU_mgv1a011711mg [Mimulus guttatus] Length = 273 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLDARAT 143 LYIGD+FL+N++DVIRPNLSVREGIEIVVSGGMSMPQILSTLD R T Sbjct: 224 LYIGDVFLVNAKDVIRPNLSVREGIEIVVSGGMSMPQILSTLDPRTT 270 >gb|EYU29801.1| hypothetical protein MIMGU_mgv1a011711mg [Mimulus guttatus] Length = 228 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLDARAT 143 LYIGD+FL+N++DVIRPNLSVREGIEIVVSGGMSMPQILSTLD R T Sbjct: 179 LYIGDVFLVNAKDVIRPNLSVREGIEIVVSGGMSMPQILSTLDPRTT 225 >ref|XP_006381720.1| hypothetical protein POPTR_0006s16320g [Populus trichocarpa] gi|550336472|gb|ERP59517.1| hypothetical protein POPTR_0006s16320g [Populus trichocarpa] Length = 263 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLDAR 137 LYIGDIFL+N++DVIRPNLSVREGIEIVVSGGMSMPQILSTLD+R Sbjct: 208 LYIGDIFLVNTKDVIRPNLSVREGIEIVVSGGMSMPQILSTLDSR 252 >ref|XP_004503445.1| PREDICTED: uncharacterized protein LOC101498421 [Cicer arietinum] Length = 265 Score = 84.3 bits (207), Expect = 2e-14 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLDARA 140 LYIGDIFL+N++DVIRPNLSVREGIEIVVSGGMSMPQILSTLD+ A Sbjct: 211 LYIGDIFLVNTKDVIRPNLSVREGIEIVVSGGMSMPQILSTLDSHA 256 >ref|XP_002284354.1| PREDICTED: uncharacterized protein LOC100262854 [Vitis vinifera] gi|297738813|emb|CBI28058.3| unnamed protein product [Vitis vinifera] Length = 266 Score = 84.3 bits (207), Expect = 2e-14 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLDARAT 143 LYIGDIFL+N +DVIRPNLSVREGIEIVVSGGMSMPQILST+D+R T Sbjct: 210 LYIGDIFLVNCKDVIRPNLSVREGIEIVVSGGMSMPQILSTVDSRIT 256 >ref|XP_007152852.1| hypothetical protein PHAVU_004G165400g [Phaseolus vulgaris] gi|561026161|gb|ESW24846.1| hypothetical protein PHAVU_004G165400g [Phaseolus vulgaris] Length = 264 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/45 (88%), Positives = 45/45 (100%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLDAR 137 LYIGDIFL+N++DVIRPNLSVREGIEIVVSGGMSMPQILST+D+R Sbjct: 208 LYIGDIFLVNTKDVIRPNLSVREGIEIVVSGGMSMPQILSTIDSR 252 >ref|XP_007013145.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508783508|gb|EOY30764.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 265 Score = 84.0 bits (206), Expect = 2e-14 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLDAR 137 LYIGDIFL+N+ DVIRPNLSVREGIEIVVSGGMSMPQILSTLD R Sbjct: 210 LYIGDIFLVNTNDVIRPNLSVREGIEIVVSGGMSMPQILSTLDTR 254 >ref|XP_006298341.1| hypothetical protein CARUB_v10014410mg [Capsella rubella] gi|482567050|gb|EOA31239.1| hypothetical protein CARUB_v10014410mg [Capsella rubella] Length = 264 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLDAR 137 LYIGDIFL+N++DVIRPNLSVREGIEIVVSGGMSMPQ+LSTLD R Sbjct: 210 LYIGDIFLVNTKDVIRPNLSVREGIEIVVSGGMSMPQVLSTLDMR 254 >ref|XP_006298340.1| hypothetical protein CARUB_v10014410mg [Capsella rubella] gi|482567049|gb|EOA31238.1| hypothetical protein CARUB_v10014410mg [Capsella rubella] Length = 224 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLDAR 137 LYIGDIFL+N++DVIRPNLSVREGIEIVVSGGMSMPQ+LSTLD R Sbjct: 170 LYIGDIFLVNTKDVIRPNLSVREGIEIVVSGGMSMPQVLSTLDMR 214 >ref|XP_003534206.1| PREDICTED: uncharacterized protein LOC100800188 [Glycine max] Length = 265 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/45 (86%), Positives = 45/45 (100%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLDAR 137 LYIGDIFL+N++DVIRPNLS+REGIEIVVSGGMSMPQILST+D+R Sbjct: 209 LYIGDIFLVNTKDVIRPNLSIREGIEIVVSGGMSMPQILSTIDSR 253 >ref|NP_001238243.1| uncharacterized protein LOC100305375 [Glycine max] gi|253314559|gb|ACT22583.1| unknown [Glycine max] Length = 265 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/45 (86%), Positives = 45/45 (100%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLDAR 137 LYIGDIFL+N++DVIRPNLS+REGIEIVVSGGMSMPQILST+D+R Sbjct: 209 LYIGDIFLVNTKDVIRPNLSIREGIEIVVSGGMSMPQILSTIDSR 253 >ref|XP_006451180.1| hypothetical protein CICLE_v10009216mg [Citrus clementina] gi|568843486|ref|XP_006475638.1| PREDICTED: uncharacterized protein LOC102620902 [Citrus sinensis] gi|557554406|gb|ESR64420.1| hypothetical protein CICLE_v10009216mg [Citrus clementina] Length = 264 Score = 83.2 bits (204), Expect = 3e-14 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLDAR 137 LYIGDIFLIN++DVIRPNLSVREGIEIVVSGGMSMPQILSTL+ R Sbjct: 209 LYIGDIFLINTKDVIRPNLSVREGIEIVVSGGMSMPQILSTLETR 253 >ref|XP_007202457.1| hypothetical protein PRUPE_ppa010091mg [Prunus persica] gi|462397988|gb|EMJ03656.1| hypothetical protein PRUPE_ppa010091mg [Prunus persica] Length = 264 Score = 83.2 bits (204), Expect = 3e-14 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLDAR 137 LYIGD+FL+N++DVIRPNLSVREGIEIVVSGGMSMPQILSTLD R Sbjct: 214 LYIGDVFLVNTKDVIRPNLSVREGIEIVVSGGMSMPQILSTLDNR 258 >ref|XP_006654686.1| PREDICTED: uncharacterized protein LOC102716783 [Oryza brachyantha] Length = 274 Score = 82.8 bits (203), Expect = 4e-14 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLD 131 LYIGDIF++NS+DVIRPNLSVREGIEIVVSGGMSMPQILSTLD Sbjct: 218 LYIGDIFMVNSKDVIRPNLSVREGIEIVVSGGMSMPQILSTLD 260 >ref|XP_003630785.1| Cov1 [Medicago truncatula] gi|355524807|gb|AET05261.1| Cov1 [Medicago truncatula] Length = 202 Score = 82.8 bits (203), Expect = 4e-14 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLDA 134 LYIGDIFL+N++DVIRPNLSVREGIEIVVSGGMSMPQILSTLD+ Sbjct: 147 LYIGDIFLVNTKDVIRPNLSVREGIEIVVSGGMSMPQILSTLDS 190 >ref|XP_002441424.1| hypothetical protein SORBIDRAFT_09g026360 [Sorghum bicolor] gi|241946709|gb|EES19854.1| hypothetical protein SORBIDRAFT_09g026360 [Sorghum bicolor] Length = 273 Score = 82.8 bits (203), Expect = 4e-14 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLD 131 LYIGDIF++NS+DVIRPNLSVREGIEIVVSGGMSMPQILSTLD Sbjct: 217 LYIGDIFMVNSKDVIRPNLSVREGIEIVVSGGMSMPQILSTLD 259 >gb|EEC79568.1| hypothetical protein OsI_20718 [Oryza sativa Indica Group] Length = 273 Score = 82.8 bits (203), Expect = 4e-14 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLD 131 LYIGDIF++NS+DVIRPNLSVREGIEIVVSGGMSMPQILSTLD Sbjct: 217 LYIGDIFMVNSKDVIRPNLSVREGIEIVVSGGMSMPQILSTLD 259 >ref|NP_001132324.1| hypothetical protein [Zea mays] gi|194694080|gb|ACF81124.1| unknown [Zea mays] gi|413949902|gb|AFW82551.1| hypothetical protein ZEAMMB73_183652 [Zea mays] Length = 273 Score = 82.8 bits (203), Expect = 4e-14 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = +3 Query: 3 LYIGDIFLINSQDVIRPNLSVREGIEIVVSGGMSMPQILSTLD 131 LYIGDIF++NS+DVIRPNLSVREGIEIVVSGGMSMPQILSTLD Sbjct: 217 LYIGDIFMVNSKDVIRPNLSVREGIEIVVSGGMSMPQILSTLD 259