BLASTX nr result
ID: Sinomenium22_contig00038027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00038027 (444 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB93216.1| Poly(rC)-binding protein 1 [Morus notabilis] 42 5e-07 >gb|EXB93216.1| Poly(rC)-binding protein 1 [Morus notabilis] Length = 462 Score = 42.0 bits (97), Expect(2) = 5e-07 Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +2 Query: 299 PSAGTTILSQLLVAIPQAGR---PKGIAIKYIQESHNTDV*VLAPEDLPVF 442 P AG + ++LLVA QAG +G +K IQES N V VL EDLP+F Sbjct: 156 PPAGAKVSTRLLVAASQAGSLIGKQGGTVKSIQESSNCIVRVLGSEDLPIF 206 Score = 37.4 bits (85), Expect(2) = 5e-07 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +3 Query: 231 PKSRDVLLRVHRQTVEGLDGDLSQVPAP 314 P + D LLRVH++ V+GLDGD S P P Sbjct: 130 PPAMDGLLRVHKRIVDGLDGDSSHAPPP 157