BLASTX nr result
ID: Sinomenium22_contig00036277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00036277 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004290588.1| PREDICTED: transcriptional corepressor SEUSS... 61 2e-07 ref|XP_002265920.1| PREDICTED: transcriptional corepressor SEUSS... 59 7e-07 ref|XP_007137521.1| hypothetical protein PHAVU_009G134000g [Phas... 57 3e-06 >ref|XP_004290588.1| PREDICTED: transcriptional corepressor SEUSS-like [Fragaria vesca subsp. vesca] Length = 901 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/42 (73%), Positives = 36/42 (85%), Gaps = 2/42 (4%) Frame = -3 Query: 124 VKLEPQMTNDQMVPQQQLQSLRN--QVKLEPQQMQTLRSLPP 5 VKLEPQ+TNDQ QQQLQS+R+ VKLEPQQ+QT+RSLPP Sbjct: 194 VKLEPQLTNDQHGQQQQLQSMRSLGPVKLEPQQLQTMRSLPP 235 >ref|XP_002265920.1| PREDICTED: transcriptional corepressor SEUSS-like [Vitis vinifera] Length = 913 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -3 Query: 124 VKLEPQMTNDQMVPQQQLQSLRN--QVKLEPQQMQTLRSLPPV 2 VKLEPQ+TNDQ QQQLQSLRN VKLEPQQ+ T+RSL PV Sbjct: 190 VKLEPQVTNDQHGQQQQLQSLRNIGPVKLEPQQIPTMRSLAPV 232 >ref|XP_007137521.1| hypothetical protein PHAVU_009G134000g [Phaseolus vulgaris] gi|561010608|gb|ESW09515.1| hypothetical protein PHAVU_009G134000g [Phaseolus vulgaris] Length = 913 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/44 (72%), Positives = 37/44 (84%), Gaps = 3/44 (6%) Frame = -3 Query: 124 VKLEPQMTNDQMVPQQQ-LQSLRN--QVKLEPQQMQTLRSLPPV 2 VKLEPQ++NDQ+ QQQ LQSLRN VKLEPQQMQT+R+L PV Sbjct: 198 VKLEPQVSNDQLGQQQQPLQSLRNLSSVKLEPQQMQTMRTLGPV 241