BLASTX nr result
ID: Sinomenium22_contig00036088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00036088 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB50016.1| hypothetical protein L484_003373 [Morus notabilis] 64 3e-08 >gb|EXB50016.1| hypothetical protein L484_003373 [Morus notabilis] Length = 208 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/58 (58%), Positives = 39/58 (67%) Frame = -3 Query: 176 MTSFAHVEEPRNCSKPCRPLLSALKDAFSQCQIFHRWLSTSSHDEDEYPVSDVDEDEE 3 MT F H EEP N SK C+ L + LKDAFS C F LSTS+ DE EYP SD DE++E Sbjct: 1 MTIFYHEEEPTNPSKRCKFLAACLKDAFSNCHDFGGCLSTSNPDE-EYPTSDFDEEQE 57