BLASTX nr result
ID: Sinomenium22_contig00036015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00036015 (1084 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007019758.1| RING/U-box superfamily protein, putative [Th... 63 2e-07 ref|XP_002319324.2| hypothetical protein POPTR_0013s09080g [Popu... 62 3e-07 ref|XP_006415082.1| hypothetical protein EUTSA_v10009296mg, part... 62 5e-07 ref|XP_002521749.1| protein with unknown function [Ricinus commu... 60 2e-06 ref|XP_002266319.2| PREDICTED: RING-H2 finger protein ATL7-like ... 59 3e-06 ref|NP_192754.1| E3 ubiquitin-protein ligase ATL59 [Arabidopsis ... 59 4e-06 ref|NP_192753.1| RING-H2 finger protein ATL7 [Arabidopsis thalia... 59 4e-06 ref|XP_006356536.1| PREDICTED: RING-H2 finger protein ATL7-like ... 59 4e-06 ref|XP_004241916.1| PREDICTED: RING-H2 finger protein ATL7-like ... 59 4e-06 ref|XP_006478348.1| PREDICTED: RING-H2 finger protein ATL7-like ... 59 5e-06 ref|XP_006441793.1| hypothetical protein CICLE_v10021842mg [Citr... 59 5e-06 ref|XP_006397093.1| hypothetical protein EUTSA_v10028921mg [Eutr... 59 5e-06 ref|XP_006288526.1| hypothetical protein CARUB_v10001798mg [Caps... 58 6e-06 ref|XP_004292408.1| PREDICTED: RING-H2 finger protein ATL7-like ... 58 6e-06 gb|EXC32478.1| E3 ubiquitin-protein ligase ATL59 [Morus notabilis] 58 8e-06 ref|XP_007201233.1| hypothetical protein PRUPE_ppa010460mg [Prun... 58 8e-06 ref|XP_003534697.1| PREDICTED: RING-H2 finger protein ATL7 isofo... 58 8e-06 ref|XP_002872495.1| zinc finger family protein [Arabidopsis lyra... 58 8e-06 >ref|XP_007019758.1| RING/U-box superfamily protein, putative [Theobroma cacao] gi|508725086|gb|EOY16983.1| RING/U-box superfamily protein, putative [Theobroma cacao] Length = 368 Score = 62.8 bits (151), Expect = 2e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 1002 RCSVCLGDYQAEDKLQQIPACGHTFHM 1082 +CSVCLGDYQAEDKLQQIPACGHTFHM Sbjct: 112 QCSVCLGDYQAEDKLQQIPACGHTFHM 138 >ref|XP_002319324.2| hypothetical protein POPTR_0013s09080g [Populus trichocarpa] gi|550325328|gb|EEE95247.2| hypothetical protein POPTR_0013s09080g [Populus trichocarpa] Length = 239 Score = 62.4 bits (150), Expect = 3e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 1002 RCSVCLGDYQAEDKLQQIPACGHTFHM 1082 RC VCLGDYQAEDKLQQIPACGHTFHM Sbjct: 99 RCPVCLGDYQAEDKLQQIPACGHTFHM 125 >ref|XP_006415082.1| hypothetical protein EUTSA_v10009296mg, partial [Eutrema salsugineum] gi|557092853|gb|ESQ33435.1| hypothetical protein EUTSA_v10009296mg, partial [Eutrema salsugineum] Length = 221 Score = 61.6 bits (148), Expect = 5e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 1002 RCSVCLGDYQAEDKLQQIPACGHTFHM 1082 +CSVCLGDYQA+DKLQQIPACGHTFHM Sbjct: 101 QCSVCLGDYQADDKLQQIPACGHTFHM 127 >ref|XP_002521749.1| protein with unknown function [Ricinus communis] gi|223538962|gb|EEF40559.1| protein with unknown function [Ricinus communis] Length = 337 Score = 59.7 bits (143), Expect = 2e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 1002 RCSVCLGDYQAEDKLQQIPACGHTFHM 1082 +C VCLGDYQAED+LQQIPACGHTFHM Sbjct: 105 QCPVCLGDYQAEDRLQQIPACGHTFHM 131 >ref|XP_002266319.2| PREDICTED: RING-H2 finger protein ATL7-like [Vitis vinifera] gi|297734760|emb|CBI16994.3| unnamed protein product [Vitis vinifera] Length = 221 Score = 59.3 bits (142), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 1002 RCSVCLGDYQAEDKLQQIPACGHTFHM 1082 +CSVCL DYQAED+LQQIPACGHTFHM Sbjct: 99 QCSVCLADYQAEDRLQQIPACGHTFHM 125 >ref|NP_192754.1| E3 ubiquitin-protein ligase ATL59 [Arabidopsis thaliana] gi|68565337|sp|Q9SN27.1|ATL59_ARATH RecName: Full=E3 ubiquitin-protein ligase ATL59; AltName: Full=RING-H2 finger protein ATL59 gi|4538980|emb|CAB39768.1| putative protein [Arabidopsis thaliana] gi|7267712|emb|CAB78139.1| putative protein [Arabidopsis thaliana] gi|21689653|gb|AAM67448.1| unknown protein [Arabidopsis thaliana] gi|66865940|gb|AAY57604.1| RING finger family protein [Arabidopsis thaliana] gi|332657449|gb|AEE82849.1| E3 ubiquitin-protein ligase ATL59 [Arabidopsis thaliana] Length = 225 Score = 58.9 bits (141), Expect = 4e-06 Identities = 23/27 (85%), Positives = 27/27 (100%) Frame = +3 Query: 1002 RCSVCLGDYQAEDKLQQIPACGHTFHM 1082 +CSVCLGDYQAE+KLQQ+P+CGHTFHM Sbjct: 96 QCSVCLGDYQAEEKLQQMPSCGHTFHM 122 >ref|NP_192753.1| RING-H2 finger protein ATL7 [Arabidopsis thaliana] gi|68565338|sp|Q9SN28.1|ATL7_ARATH RecName: Full=RING-H2 finger protein ATL7 gi|4538979|emb|CAB39767.1| putative protein [Arabidopsis thaliana] gi|7267711|emb|CAB78138.1| putative protein [Arabidopsis thaliana] gi|21689651|gb|AAM67447.1| unknown protein [Arabidopsis thaliana] gi|332657448|gb|AEE82848.1| RING-H2 finger protein ATL7 [Arabidopsis thaliana] Length = 236 Score = 58.9 bits (141), Expect = 4e-06 Identities = 23/27 (85%), Positives = 27/27 (100%) Frame = +3 Query: 1002 RCSVCLGDYQAEDKLQQIPACGHTFHM 1082 +CSVCLGDYQAE+KLQQ+P+CGHTFHM Sbjct: 110 QCSVCLGDYQAEEKLQQMPSCGHTFHM 136 >ref|XP_006356536.1| PREDICTED: RING-H2 finger protein ATL7-like [Solanum tuberosum] Length = 287 Score = 58.9 bits (141), Expect = 4e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 1002 RCSVCLGDYQAEDKLQQIPACGHTFHM 1082 +CSVCLGDY A+DKLQQIPACGHTFHM Sbjct: 117 QCSVCLGDYLADDKLQQIPACGHTFHM 143 >ref|XP_004241916.1| PREDICTED: RING-H2 finger protein ATL7-like [Solanum lycopersicum] Length = 287 Score = 58.9 bits (141), Expect = 4e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 1002 RCSVCLGDYQAEDKLQQIPACGHTFHM 1082 +CSVCLGDY A+DKLQQIPACGHTFHM Sbjct: 117 QCSVCLGDYLADDKLQQIPACGHTFHM 143 >ref|XP_006478348.1| PREDICTED: RING-H2 finger protein ATL7-like [Citrus sinensis] Length = 251 Score = 58.5 bits (140), Expect = 5e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +3 Query: 1002 RCSVCLGDYQAEDKLQQIPACGHTFHM 1082 +CSVCL DYQAEDKLQQIPACGH FHM Sbjct: 103 QCSVCLADYQAEDKLQQIPACGHAFHM 129 >ref|XP_006441793.1| hypothetical protein CICLE_v10021842mg [Citrus clementina] gi|557544055|gb|ESR55033.1| hypothetical protein CICLE_v10021842mg [Citrus clementina] Length = 251 Score = 58.5 bits (140), Expect = 5e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +3 Query: 1002 RCSVCLGDYQAEDKLQQIPACGHTFHM 1082 +CSVCL DYQAEDKLQQIPACGH FHM Sbjct: 103 QCSVCLADYQAEDKLQQIPACGHAFHM 129 >ref|XP_006397093.1| hypothetical protein EUTSA_v10028921mg [Eutrema salsugineum] gi|557098110|gb|ESQ38546.1| hypothetical protein EUTSA_v10028921mg [Eutrema salsugineum] Length = 240 Score = 58.5 bits (140), Expect = 5e-06 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = +3 Query: 1005 CSVCLGDYQAEDKLQQIPACGHTFHM 1082 CSVCLGDYQA++KLQQ+PACGHTFHM Sbjct: 115 CSVCLGDYQADEKLQQMPACGHTFHM 140 >ref|XP_006288526.1| hypothetical protein CARUB_v10001798mg [Capsella rubella] gi|482557232|gb|EOA21424.1| hypothetical protein CARUB_v10001798mg [Capsella rubella] Length = 250 Score = 58.2 bits (139), Expect = 6e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +3 Query: 1005 CSVCLGDYQAEDKLQQIPACGHTFHM 1082 CSVCLGDYQAE+KLQQ+P CGHTFHM Sbjct: 115 CSVCLGDYQAEEKLQQMPTCGHTFHM 140 >ref|XP_004292408.1| PREDICTED: RING-H2 finger protein ATL7-like [Fragaria vesca subsp. vesca] Length = 235 Score = 58.2 bits (139), Expect = 6e-06 Identities = 25/33 (75%), Positives = 29/33 (87%), Gaps = 3/33 (9%) Frame = +3 Query: 993 FFCR---CSVCLGDYQAEDKLQQIPACGHTFHM 1082 FF R C+VCLGDYQA+D+LQQIPACGHTFH+ Sbjct: 92 FFVRDTQCAVCLGDYQADDRLQQIPACGHTFHI 124 >gb|EXC32478.1| E3 ubiquitin-protein ligase ATL59 [Morus notabilis] Length = 333 Score = 57.8 bits (138), Expect = 8e-06 Identities = 22/27 (81%), Positives = 27/27 (100%) Frame = +3 Query: 1002 RCSVCLGDYQAEDKLQQIPACGHTFHM 1082 +CSVCLGDY+A+D+LQQIPACGHTFH+ Sbjct: 206 QCSVCLGDYEADDRLQQIPACGHTFHI 232 >ref|XP_007201233.1| hypothetical protein PRUPE_ppa010460mg [Prunus persica] gi|462396633|gb|EMJ02432.1| hypothetical protein PRUPE_ppa010460mg [Prunus persica] Length = 249 Score = 57.8 bits (138), Expect = 8e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = +3 Query: 1002 RCSVCLGDYQAEDKLQQIPACGHTFHM 1082 +CSVCLGDYQAED+LQQIPAC HTFH+ Sbjct: 108 QCSVCLGDYQAEDRLQQIPACAHTFHI 134 >ref|XP_003534697.1| PREDICTED: RING-H2 finger protein ATL7 isoform X1 [Glycine max] gi|571475675|ref|XP_006586737.1| PREDICTED: RING-H2 finger protein ATL7 isoform X2 [Glycine max] Length = 219 Score = 57.8 bits (138), Expect = 8e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 1002 RCSVCLGDYQAEDKLQQIPACGHTFHM 1082 +CSVCL DYQAED+LQQIPACGHTFHM Sbjct: 110 QCSVCLLDYQAEDRLQQIPACGHTFHM 136 >ref|XP_002872495.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297318332|gb|EFH48754.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 237 Score = 57.8 bits (138), Expect = 8e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = +3 Query: 1002 RCSVCLGDYQAEDKLQQIPACGHTFHM 1082 +CSVCL DYQAE+KLQQ+PACGHTFHM Sbjct: 110 QCSVCLADYQAEEKLQQMPACGHTFHM 136