BLASTX nr result
ID: Sinomenium22_contig00035981
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00035981 (456 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002323527.1| mitochondrial substrate carrier family prote... 102 4e-20 ref|XP_007205473.1| hypothetical protein PRUPE_ppa008053mg [Prun... 100 2e-19 gb|EPS61182.1| hypothetical protein M569_13615, partial [Genlise... 100 3e-19 ref|XP_004165043.1| PREDICTED: mitochondrial substrate carrier f... 100 3e-19 ref|XP_004142050.1| PREDICTED: mitochondrial substrate carrier f... 100 3e-19 ref|XP_007026884.1| Mitochondrial substrate carrier family prote... 100 4e-19 ref|XP_004490851.1| PREDICTED: mitochondrial substrate carrier f... 100 4e-19 ref|XP_004302699.1| PREDICTED: mitochondrial substrate carrier f... 100 4e-19 gb|EYU41786.1| hypothetical protein MIMGU_mgv1a009733mg [Mimulus... 99 5e-19 ref|XP_006595882.1| PREDICTED: mitochondrial substrate carrier f... 99 8e-19 ref|XP_003544163.1| PREDICTED: mitochondrial substrate carrier f... 99 8e-19 ref|XP_006602613.1| PREDICTED: mitochondrial substrate carrier f... 98 1e-18 ref|XP_003551509.1| PREDICTED: mitochondrial substrate carrier f... 98 1e-18 ref|XP_002529856.1| Mitochondrial deoxynucleotide carrier, putat... 98 1e-18 gb|EYU26616.1| hypothetical protein MIMGU_mgv1a009595mg [Mimulus... 97 2e-18 ref|XP_007140462.1| hypothetical protein PHAVU_008G114400g [Phas... 97 2e-18 ref|XP_007134012.1| hypothetical protein PHAVU_010G011800g [Phas... 97 2e-18 ref|XP_006429213.1| hypothetical protein CICLE_v10012050mg [Citr... 97 2e-18 ref|XP_003616506.1| Mitochondrial carrier like protein [Medicago... 97 2e-18 ref|XP_002282149.1| PREDICTED: mitochondrial substrate carrier f... 97 2e-18 >ref|XP_002323527.1| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|222868157|gb|EEF05288.1| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 346 Score = 102 bits (255), Expect = 4e-20 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIKM 161 GRA +Y SGLFGTF HI+HTEGFRG+YRGILPEYYKVVPSVGIVFMTYET+KM Sbjct: 286 GRACIYTSGLFGTFAHIIHTEGFRGMYRGILPEYYKVVPSVGIVFMTYETLKM 338 >ref|XP_007205473.1| hypothetical protein PRUPE_ppa008053mg [Prunus persica] gi|462401115|gb|EMJ06672.1| hypothetical protein PRUPE_ppa008053mg [Prunus persica] Length = 347 Score = 100 bits (250), Expect = 2e-19 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIKM 161 GRAR+YN+GL GTF+HI+ TEG RGLYRGILPEYYKVVPSVGIVFMTYET+KM Sbjct: 286 GRARIYNTGLVGTFKHIIRTEGLRGLYRGILPEYYKVVPSVGIVFMTYETLKM 338 >gb|EPS61182.1| hypothetical protein M569_13615, partial [Genlisea aurea] Length = 319 Score = 100 bits (248), Expect = 3e-19 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIK 158 GRARVYN+GLFG FRHIV TEG RGLYRGILPEYYKVVP VGIVFMTYET+K Sbjct: 260 GRARVYNTGLFGAFRHIVRTEGLRGLYRGILPEYYKVVPGVGIVFMTYETLK 311 >ref|XP_004165043.1| PREDICTED: mitochondrial substrate carrier family protein B-like [Cucumis sativus] Length = 349 Score = 100 bits (248), Expect = 3e-19 Identities = 44/52 (84%), Positives = 51/52 (98%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIK 158 G+AR+YN+GL+GTF+HIV TEGF+GLYRGILPEYYKVVPSVGIVFMTYET+K Sbjct: 288 GQARIYNTGLYGTFKHIVKTEGFKGLYRGILPEYYKVVPSVGIVFMTYETLK 339 >ref|XP_004142050.1| PREDICTED: mitochondrial substrate carrier family protein B-like [Cucumis sativus] Length = 349 Score = 100 bits (248), Expect = 3e-19 Identities = 44/52 (84%), Positives = 51/52 (98%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIK 158 G+AR+YN+GL+GTF+HIV TEGF+GLYRGILPEYYKVVPSVGIVFMTYET+K Sbjct: 288 GQARIYNTGLYGTFKHIVKTEGFKGLYRGILPEYYKVVPSVGIVFMTYETLK 339 >ref|XP_007026884.1| Mitochondrial substrate carrier family protein [Theobroma cacao] gi|508715489|gb|EOY07386.1| Mitochondrial substrate carrier family protein [Theobroma cacao] Length = 355 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIKM 161 GRARVY +GLFGTFRHI+ +EG RGLYRGILPEYYKVVP VGIVFMTYET+KM Sbjct: 294 GRARVYTTGLFGTFRHIIQSEGLRGLYRGILPEYYKVVPGVGIVFMTYETLKM 346 >ref|XP_004490851.1| PREDICTED: mitochondrial substrate carrier family protein B-like isoform X1 [Cicer arietinum] Length = 327 Score = 99.8 bits (247), Expect = 4e-19 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIKM 161 GRARVYN+G+FG F+HI+ TEGFRGLYRGILPEYYKVVP VGI FMTYET+KM Sbjct: 267 GRARVYNTGIFGMFKHIIRTEGFRGLYRGILPEYYKVVPGVGICFMTYETLKM 319 >ref|XP_004302699.1| PREDICTED: mitochondrial substrate carrier family protein B-like [Fragaria vesca subsp. vesca] Length = 334 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIKM 161 GRARVYN+G+ GTFRHI+ EG RGLYRGILPEYYKVVPSVGIVFMTYET+KM Sbjct: 273 GRARVYNTGIVGTFRHIIRNEGLRGLYRGILPEYYKVVPSVGIVFMTYETLKM 325 >gb|EYU41786.1| hypothetical protein MIMGU_mgv1a009733mg [Mimulus guttatus] Length = 333 Score = 99.4 bits (246), Expect = 5e-19 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIK 158 GR R+Y +GLFGTFRHI+ +EGFRGLYRGILPEYYKVVPSVGIVFMTYET+K Sbjct: 273 GRPRIYTAGLFGTFRHIIRSEGFRGLYRGILPEYYKVVPSVGIVFMTYETLK 324 >ref|XP_006595882.1| PREDICTED: mitochondrial substrate carrier family protein V-like isoform X2 [Glycine max] Length = 331 Score = 98.6 bits (244), Expect = 8e-19 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIKM 161 GRARVY +GL+G FRHI+ TEGFRGLYRGILPEYYKVVP VGI FMTYET+KM Sbjct: 271 GRARVYTTGLYGVFRHIIRTEGFRGLYRGILPEYYKVVPGVGICFMTYETLKM 323 >ref|XP_003544163.1| PREDICTED: mitochondrial substrate carrier family protein V-like isoform X1 [Glycine max] Length = 326 Score = 98.6 bits (244), Expect = 8e-19 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIKM 161 GRARVY +GL+G FRHI+ TEGFRGLYRGILPEYYKVVP VGI FMTYET+KM Sbjct: 266 GRARVYTTGLYGVFRHIIRTEGFRGLYRGILPEYYKVVPGVGICFMTYETLKM 318 >ref|XP_006602613.1| PREDICTED: mitochondrial substrate carrier family protein B-like isoform X2 [Glycine max] Length = 321 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIKM 161 GRARVYN+ LFGTF+HI+ EG RGLYRGILPEYYKVVPS+GIVFMTYET+KM Sbjct: 261 GRARVYNTSLFGTFKHIIQNEGVRGLYRGILPEYYKVVPSLGIVFMTYETLKM 313 >ref|XP_003551509.1| PREDICTED: mitochondrial substrate carrier family protein B-like isoform X1 [Glycine max] Length = 332 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIKM 161 GRARVYN+ LFGTF+HI+ EG RGLYRGILPEYYKVVPS+GIVFMTYET+KM Sbjct: 272 GRARVYNTSLFGTFKHIIQNEGVRGLYRGILPEYYKVVPSLGIVFMTYETLKM 324 >ref|XP_002529856.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis] gi|223530632|gb|EEF32506.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis] Length = 363 Score = 97.8 bits (242), Expect = 1e-18 Identities = 45/53 (84%), Positives = 48/53 (90%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIKM 161 GRARVY +GLFGTF HI+ EG RGLYRGILPEYYKVVPSVGIVFMTYET+KM Sbjct: 303 GRARVYTTGLFGTFGHIIRQEGLRGLYRGILPEYYKVVPSVGIVFMTYETLKM 355 >gb|EYU26616.1| hypothetical protein MIMGU_mgv1a009595mg [Mimulus guttatus] Length = 337 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/52 (82%), Positives = 49/52 (94%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIK 158 GRARVY+ G+FGTFRHI+ +EG RGLYRGI+PEYYKVVPSVGIVFMTYET+K Sbjct: 276 GRARVYDMGIFGTFRHIIRSEGLRGLYRGIMPEYYKVVPSVGIVFMTYETLK 327 >ref|XP_007140462.1| hypothetical protein PHAVU_008G114400g [Phaseolus vulgaris] gi|561013595|gb|ESW12456.1| hypothetical protein PHAVU_008G114400g [Phaseolus vulgaris] Length = 327 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIKM 161 GRARVYN+ LFGTF+HI+ EG RGLYRGILPEYYKVVPSVGIVFMTYET+K+ Sbjct: 268 GRARVYNTSLFGTFKHILQNEGLRGLYRGILPEYYKVVPSVGIVFMTYETLKV 320 >ref|XP_007134012.1| hypothetical protein PHAVU_010G011800g [Phaseolus vulgaris] gi|561007057|gb|ESW06006.1| hypothetical protein PHAVU_010G011800g [Phaseolus vulgaris] Length = 329 Score = 97.4 bits (241), Expect = 2e-18 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIKM 161 GRARVYN+GLFG F IV TEG RGLYRGILPEYYKVVPSVGIVFMTYET+KM Sbjct: 269 GRARVYNTGLFGAFGRIVQTEGVRGLYRGILPEYYKVVPSVGIVFMTYETLKM 321 >ref|XP_006429213.1| hypothetical protein CICLE_v10012050mg [Citrus clementina] gi|557531270|gb|ESR42453.1| hypothetical protein CICLE_v10012050mg [Citrus clementina] Length = 358 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIKM 161 GRARVYN+GL GTFR+I+ +EG RGLYRGILPEYYKVVP VGIVFMTYET+KM Sbjct: 297 GRARVYNNGLLGTFRYIIQSEGLRGLYRGILPEYYKVVPGVGIVFMTYETLKM 349 >ref|XP_003616506.1| Mitochondrial carrier like protein [Medicago truncatula] gi|355517841|gb|AES99464.1| Mitochondrial carrier like protein [Medicago truncatula] Length = 440 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIKM 161 GRARVYN+GLFGTF+HI +EG RGLYRGILPEYYKVVP VGI FMTYET+KM Sbjct: 380 GRARVYNTGLFGTFKHIFRSEGLRGLYRGILPEYYKVVPGVGICFMTYETLKM 432 >ref|XP_002282149.1| PREDICTED: mitochondrial substrate carrier family protein B isoform 1 [Vitis vinifera] Length = 346 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/52 (84%), Positives = 47/52 (90%) Frame = +3 Query: 3 GRARVYNSGLFGTFRHIVHTEGFRGLYRGILPEYYKVVPSVGIVFMTYETIK 158 GRARVY +GLFGTFRHI+ TEG RGLYRGILPEYYKVVP VGI FMTYET+K Sbjct: 286 GRARVYTTGLFGTFRHIIRTEGLRGLYRGILPEYYKVVPGVGICFMTYETLK 337