BLASTX nr result
ID: Sinomenium22_contig00035881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00035881 (574 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21837.3| unnamed protein product [Vitis vinifera] 59 7e-07 >emb|CBI21837.3| unnamed protein product [Vitis vinifera] Length = 388 Score = 59.3 bits (142), Expect = 7e-07 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 2/46 (4%) Frame = +2 Query: 65 KEVKMADL--QLMERARSVKLFFIKGVKIVGDYCKKGWHKVKPLKG 196 K KMA+ QL ERAR +K FF KGVKIVGD CKKGW+KV+ ++G Sbjct: 326 KRKKMAEFEKQLKERARELKTFFKKGVKIVGDSCKKGWYKVRHMRG 371