BLASTX nr result
ID: Sinomenium22_contig00035692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00035692 (516 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT33750.1| Putative chromatin-remodeling complex ATPase chai... 59 5e-07 >gb|EMT33750.1| Putative chromatin-remodeling complex ATPase chain [Aegilops tauschii] Length = 950 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +2 Query: 2 SCGNSILL-CKVRLHTIDPKWSDPSPGPRIRGSFVHRAALY 121 S GNS+LL C+ RL TIDPKWSDPSP P GS++HRAAL+ Sbjct: 23 SPGNSLLLKCRERLRTIDPKWSDPSPDPCASGSYMHRAALF 63