BLASTX nr result
ID: Sinomenium22_contig00035439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00035439 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006483251.1| PREDICTED: probable E3 ubiquitin-protein lig... 57 3e-06 ref|XP_006438569.1| hypothetical protein CICLE_v10031688mg [Citr... 57 3e-06 ref|XP_006438568.1| hypothetical protein CICLE_v10031688mg [Citr... 57 3e-06 >ref|XP_006483251.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2-like [Citrus sinensis] Length = 410 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = -2 Query: 125 LGHSIYGFGSGKHGSLGVSKDKIRNLFNLPQLALGLEGVE 6 LG+ +YGFGSGK G LGVSKD+IR++ +LPQ+ +GL+G+E Sbjct: 192 LGNQVYGFGSGKRGQLGVSKDRIRSV-SLPQVTIGLDGIE 230 >ref|XP_006438569.1| hypothetical protein CICLE_v10031688mg [Citrus clementina] gi|557540765|gb|ESR51809.1| hypothetical protein CICLE_v10031688mg [Citrus clementina] Length = 328 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = -2 Query: 125 LGHSIYGFGSGKHGSLGVSKDKIRNLFNLPQLALGLEGVE 6 LG+ +YGFGSGK G LGVSKD+IR++ +LPQ+ +GL+G+E Sbjct: 192 LGNQVYGFGSGKRGQLGVSKDRIRSV-SLPQVTIGLDGIE 230 >ref|XP_006438568.1| hypothetical protein CICLE_v10031688mg [Citrus clementina] gi|557540764|gb|ESR51808.1| hypothetical protein CICLE_v10031688mg [Citrus clementina] Length = 410 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = -2 Query: 125 LGHSIYGFGSGKHGSLGVSKDKIRNLFNLPQLALGLEGVE 6 LG+ +YGFGSGK G LGVSKD+IR++ +LPQ+ +GL+G+E Sbjct: 192 LGNQVYGFGSGKRGQLGVSKDRIRSV-SLPQVTIGLDGIE 230