BLASTX nr result
ID: Sinomenium22_contig00035362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00035362 (349 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007199580.1| hypothetical protein PRUPE_ppb023495mg, part... 49 8e-08 ref|XP_007224597.1| hypothetical protein PRUPE_ppa027084mg, part... 47 5e-06 >ref|XP_007199580.1| hypothetical protein PRUPE_ppb023495mg, partial [Prunus persica] gi|462394980|gb|EMJ00779.1| hypothetical protein PRUPE_ppb023495mg, partial [Prunus persica] Length = 197 Score = 48.9 bits (115), Expect(2) = 8e-08 Identities = 24/44 (54%), Positives = 29/44 (65%) Frame = +2 Query: 197 QIISPFASFLWNSNSPSKVKVFGWLLAINKLNVCDVLQRRNSFL 328 QI SP AS +W S P KVK WLLA+ KLN CD LQ++ F+ Sbjct: 41 QIFSP-ASQIWKSKVPPKVKFHVWLLALRKLNTCDHLQKKRPFM 83 Score = 33.1 bits (74), Expect(2) = 8e-08 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = +3 Query: 102 RDDSRIWALDKNGSFSCKSLFHFL 173 R DSR W LD +G FSCKS FL Sbjct: 11 RSDSRRWKLDGSGLFSCKSYSSFL 34 >ref|XP_007224597.1| hypothetical protein PRUPE_ppa027084mg, partial [Prunus persica] gi|462421533|gb|EMJ25796.1| hypothetical protein PRUPE_ppa027084mg, partial [Prunus persica] Length = 295 Score = 46.6 bits (109), Expect(2) = 5e-06 Identities = 20/40 (50%), Positives = 29/40 (72%) Frame = +2 Query: 209 PFASFLWNSNSPSKVKVFGWLLAINKLNVCDVLQRRNSFL 328 PF S +W + SP KVKVF WL+A+ K+N D++QR+ F+ Sbjct: 122 PF-SLVWKAKSPPKVKVFVWLVALGKVNTSDLVQRKRPFM 160 Score = 29.3 bits (64), Expect(2) = 5e-06 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 90 LHVGRDDSRIWALDKNGSFSCKSLFHFL 173 L + D R W L+ +GSF+CKS FL Sbjct: 84 LCASKRDRRRWDLEDSGSFTCKSFQSFL 111