BLASTX nr result
ID: Sinomenium22_contig00035107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00035107 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007579629.1| putative glutaredoxin protein [Neofusicoccum... 116 3e-24 ref|XP_001244264.1| predicted protein [Coccidioides immitis RS] ... 114 1e-23 gb|EME48513.1| hypothetical protein DOTSEDRAFT_67524 [Dothistrom... 113 2e-23 gb|EON63519.1| glutaredoxin 3 [Coniosporium apollinis CBS 100218] 112 7e-23 gb|EME88989.1| hypothetical protein MYCFIDRAFT_55506 [Pseudocerc... 112 7e-23 ref|XP_003852675.1| putative P450 monooxygenase [Zymoseptoria tr... 109 5e-22 gb|EMD00772.1| hypothetical protein BAUCODRAFT_100257 [Baudoinia... 108 8e-22 dbj|GAD96479.1| glutaredoxin Grx1, putative [Byssochlamys specta... 108 1e-21 gb|EMF17576.1| glutaredoxin Grx1 [Sphaerulina musiva SO2202] 107 1e-21 ref|XP_007289377.1| glutaredoxin [Marssonina brunnea f. sp. 'mul... 107 1e-21 ref|XP_002582787.1| glutaredoxin [Uncinocarpus reesii 1704] gi|2... 107 1e-21 ref|XP_002144051.1| glutaredoxin Grx1, putative [Talaromyces mar... 107 1e-21 gb|EOA90261.1| hypothetical protein SETTUDRAFT_158864 [Setosphae... 107 2e-21 ref|XP_002480431.1| glutaredoxin Grx1, putative [Talaromyces sti... 107 2e-21 gb|EXJ95901.1| glutaredoxin 3 [Capronia coronata CBS 617.96] 106 3e-21 ref|XP_001930380.1| glutaredoxin domain containing protein [Pyre... 105 5e-21 gb|ETN45470.1| glutaredoxin [Cyphellophora europaea CBS 101466] 105 9e-21 ref|XP_003299699.1| hypothetical protein PTT_10750 [Pyrenophora ... 105 9e-21 gb|EXJ81237.1| glutaredoxin 3 [Capronia epimyces CBS 606.96] 104 1e-20 gb|EXJ63767.1| glutaredoxin 3 [Cladophialophora yegresii CBS 114... 104 1e-20 >ref|XP_007579629.1| putative glutaredoxin protein [Neofusicoccum parvum UCRNP2] gi|485929536|gb|EOD52910.1| putative glutaredoxin protein [Neofusicoccum parvum UCRNP2] Length = 102 Score = 116 bits (291), Expect = 3e-24 Identities = 54/66 (81%), Positives = 64/66 (96%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 C+ATKSLLS++GAKYYAIELDQVDDG+A+Q ALEEITGQR+VPN+FI+ KHIGGNSDLQ+ Sbjct: 28 CRATKSLLSELGAKYYAIELDQVDDGAAIQDALEEITGQRSVPNIFIDKKHIGGNSDLQS 87 Query: 183 KKSQLP 200 KKS+LP Sbjct: 88 KKSELP 93 >ref|XP_001244264.1| predicted protein [Coccidioides immitis RS] gi|303317104|ref|XP_003068554.1| glutaredoxin, putative [Coccidioides posadasii C735 delta SOWgp] gi|240108235|gb|EER26409.1| glutaredoxin, putative [Coccidioides posadasii C735 delta SOWgp] gi|320038461|gb|EFW20397.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] gi|392870982|gb|EJB12099.1| glutaredoxin [Coccidioides immitis RS] Length = 104 Score = 114 bits (285), Expect = 1e-23 Identities = 53/66 (80%), Positives = 62/66 (93%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 CKATKSLLS GAKY+ +ELDQVDDG+A+Q+ALEEIT QRTVPN+FI+HKHIGGNSDLQA Sbjct: 28 CKATKSLLSSEGAKYFTMELDQVDDGAAIQAALEEITNQRTVPNIFIDHKHIGGNSDLQA 87 Query: 183 KKSQLP 200 +KS+LP Sbjct: 88 RKSELP 93 >gb|EME48513.1| hypothetical protein DOTSEDRAFT_67524 [Dothistroma septosporum NZE10] Length = 101 Score = 113 bits (283), Expect = 2e-23 Identities = 54/66 (81%), Positives = 61/66 (92%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 CK+TKSLLS++G K Y IELDQVDDG+A+Q ALEEIT QR+VPNVFINHKHIGGNS+LQA Sbjct: 27 CKSTKSLLSELGVKPYIIELDQVDDGAAIQDALEEITNQRSVPNVFINHKHIGGNSELQA 86 Query: 183 KKSQLP 200 KKSQLP Sbjct: 87 KKSQLP 92 >gb|EON63519.1| glutaredoxin 3 [Coniosporium apollinis CBS 100218] Length = 102 Score = 112 bits (279), Expect = 7e-23 Identities = 53/66 (80%), Positives = 61/66 (92%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 CKATK LLS+MGAK+YAIELDQVDDG+A+Q ALEE+T QRTVPNVFI+ KHIGGNSDLQ+ Sbjct: 28 CKATKQLLSEMGAKFYAIELDQVDDGAAIQDALEEMTHQRTVPNVFIDKKHIGGNSDLQS 87 Query: 183 KKSQLP 200 KK +LP Sbjct: 88 KKKELP 93 >gb|EME88989.1| hypothetical protein MYCFIDRAFT_55506 [Pseudocercospora fijiensis CIRAD86] Length = 101 Score = 112 bits (279), Expect = 7e-23 Identities = 53/66 (80%), Positives = 60/66 (90%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 CKATKSLLS+MG K + IELDQVDDG+A+Q ALEEIT QR+VPN+FI+HKHIGGNSDLQ Sbjct: 27 CKATKSLLSEMGVKPFIIELDQVDDGAAIQDALEEITSQRSVPNIFIDHKHIGGNSDLQG 86 Query: 183 KKSQLP 200 KKSQLP Sbjct: 87 KKSQLP 92 >ref|XP_003852675.1| putative P450 monooxygenase [Zymoseptoria tritici IPO323] gi|339472556|gb|EGP87651.1| putative P450 monooxygenase [Zymoseptoria tritici IPO323] Length = 101 Score = 109 bits (272), Expect = 5e-22 Identities = 52/66 (78%), Positives = 60/66 (90%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 CKATKSLLS+ GAK + IELDQVDDG+A+Q ALEEIT QR+VPN+FIN KHIGGNS+LQ+ Sbjct: 27 CKATKSLLSEQGAKAFIIELDQVDDGAAIQDALEEITSQRSVPNIFINKKHIGGNSELQS 86 Query: 183 KKSQLP 200 KKSQLP Sbjct: 87 KKSQLP 92 >gb|EMD00772.1| hypothetical protein BAUCODRAFT_100257 [Baudoinia compniacensis UAMH 10762] Length = 101 Score = 108 bits (270), Expect = 8e-22 Identities = 52/66 (78%), Positives = 60/66 (90%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 CKATKSLLS+MGAK Y IELDQVDDG+A+Q ALEE+T QR+VPN+FI+ KHIGGNSDLQ Sbjct: 27 CKATKSLLSEMGAKPYIIELDQVDDGAAIQDALEEMTHQRSVPNIFIDKKHIGGNSDLQG 86 Query: 183 KKSQLP 200 KKS+LP Sbjct: 87 KKSELP 92 >dbj|GAD96479.1| glutaredoxin Grx1, putative [Byssochlamys spectabilis No. 5] Length = 103 Score = 108 bits (269), Expect = 1e-21 Identities = 47/66 (71%), Positives = 62/66 (93%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 CK+TKS LS++GAKY A+ELDQ+DDG+A+Q ALEE+TGQR+VPN+FIN +HIGGNSDLQ+ Sbjct: 29 CKSTKSTLSELGAKYIALELDQIDDGAAIQDALEEVTGQRSVPNIFINKQHIGGNSDLQS 88 Query: 183 KKSQLP 200 +K++LP Sbjct: 89 RKAELP 94 >gb|EMF17576.1| glutaredoxin Grx1 [Sphaerulina musiva SO2202] Length = 101 Score = 107 bits (268), Expect = 1e-21 Identities = 52/66 (78%), Positives = 59/66 (89%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 CKATKSLLS++GAK Y IELDQVDDG+A+Q ALEE+T QR+VPN+FI KHIGGNSDLQ Sbjct: 27 CKATKSLLSEVGAKPYIIELDQVDDGAAIQDALEEMTNQRSVPNIFIAKKHIGGNSDLQG 86 Query: 183 KKSQLP 200 KKSQLP Sbjct: 87 KKSQLP 92 >ref|XP_007289377.1| glutaredoxin [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406867768|gb|EKD20806.1| glutaredoxin [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 102 Score = 107 bits (268), Expect = 1e-21 Identities = 50/67 (74%), Positives = 60/67 (89%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 CKATK+LL++MGAKYY IELDQVDDGSA+Q+AL+EI GQ +VPN++I KHIGGNSDLQA Sbjct: 28 CKATKALLTEMGAKYYTIELDQVDDGSAIQAALKEINGQTSVPNIYIKQKHIGGNSDLQA 87 Query: 183 KKSQLPT 203 KS LP+ Sbjct: 88 MKSTLPS 94 >ref|XP_002582787.1| glutaredoxin [Uncinocarpus reesii 1704] gi|237908294|gb|EEP82695.1| glutaredoxin [Uncinocarpus reesii 1704] Length = 104 Score = 107 bits (268), Expect = 1e-21 Identities = 48/66 (72%), Positives = 61/66 (92%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 C+ATKSLL++ GA ++ +ELDQVDDG+A+Q+ALEE+T QRTVPNVFI+HKHIGGNSDLQA Sbjct: 28 CRATKSLLTEQGADFFTMELDQVDDGAAIQAALEELTSQRTVPNVFIDHKHIGGNSDLQA 87 Query: 183 KKSQLP 200 +K +LP Sbjct: 88 RKGELP 93 >ref|XP_002144051.1| glutaredoxin Grx1, putative [Talaromyces marneffei ATCC 18224] gi|212527790|ref|XP_002144052.1| glutaredoxin Grx1, putative [Talaromyces marneffei ATCC 18224] gi|210073449|gb|EEA27536.1| glutaredoxin Grx1, putative [Talaromyces marneffei ATCC 18224] gi|210073450|gb|EEA27537.1| glutaredoxin Grx1, putative [Talaromyces marneffei ATCC 18224] Length = 102 Score = 107 bits (268), Expect = 1e-21 Identities = 48/66 (72%), Positives = 61/66 (92%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 CK+TKSLL+ +GA+YY +ELDQVDDG+A+Q ALEEIT QR+VPN+FIN +HIGGNSDLQA Sbjct: 28 CKSTKSLLTSLGAQYYVLELDQVDDGAAIQDALEEITSQRSVPNIFINKQHIGGNSDLQA 87 Query: 183 KKSQLP 200 +K++LP Sbjct: 88 RKNELP 93 >gb|EOA90261.1| hypothetical protein SETTUDRAFT_158864 [Setosphaeria turcica Et28A] Length = 134 Score = 107 bits (266), Expect = 2e-21 Identities = 52/67 (77%), Positives = 58/67 (86%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 C+ TK LLS+ GAK+YAIELDQVDDGSA+Q+AL EITGQ TVPN+FI KHIGGNSDLQA Sbjct: 60 CRQTKQLLSESGAKFYAIELDQVDDGSAIQAALGEITGQTTVPNIFIAQKHIGGNSDLQA 119 Query: 183 KKSQLPT 203 KK QL T Sbjct: 120 KKGQLNT 126 >ref|XP_002480431.1| glutaredoxin Grx1, putative [Talaromyces stipitatus ATCC 10500] gi|242784658|ref|XP_002480432.1| glutaredoxin Grx1, putative [Talaromyces stipitatus ATCC 10500] gi|218720578|gb|EED19997.1| glutaredoxin Grx1, putative [Talaromyces stipitatus ATCC 10500] gi|218720579|gb|EED19998.1| glutaredoxin Grx1, putative [Talaromyces stipitatus ATCC 10500] Length = 102 Score = 107 bits (266), Expect = 2e-21 Identities = 49/66 (74%), Positives = 58/66 (87%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 CKATKSLLS +GA YY +ELDQVDDG+A+Q ALEEIT QR+VPN+FIN +HIGGNSDLQ Sbjct: 28 CKATKSLLSGLGAPYYVLELDQVDDGAAIQDALEEITSQRSVPNIFINKQHIGGNSDLQG 87 Query: 183 KKSQLP 200 +K +LP Sbjct: 88 RKDELP 93 >gb|EXJ95901.1| glutaredoxin 3 [Capronia coronata CBS 617.96] Length = 102 Score = 106 bits (265), Expect = 3e-21 Identities = 50/65 (76%), Positives = 56/65 (86%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 C+A+KSLL AKYY +ELD+VDDG A+Q ALEEITGQRTVPN+FI HKHIGGNSDLQA Sbjct: 28 CRASKSLLDQKHAKYYLLELDEVDDGPAIQDALEEITGQRTVPNIFIGHKHIGGNSDLQA 87 Query: 183 KKSQL 197 KK QL Sbjct: 88 KKGQL 92 >ref|XP_001930380.1| glutaredoxin domain containing protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187971986|gb|EDU39485.1| glutaredoxin domain containing protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 102 Score = 105 bits (263), Expect = 5e-21 Identities = 49/66 (74%), Positives = 58/66 (87%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 C+ TK LL+D GAK+YAIELDQVDDGSAMQ+AL ++TGQ +VPN+FI KHIGGNSDLQA Sbjct: 28 CRQTKQLLTDKGAKFYAIELDQVDDGSAMQAALGDLTGQTSVPNIFIAQKHIGGNSDLQA 87 Query: 183 KKSQLP 200 KK +LP Sbjct: 88 KKGELP 93 >gb|ETN45470.1| glutaredoxin [Cyphellophora europaea CBS 101466] Length = 102 Score = 105 bits (261), Expect = 9e-21 Identities = 50/65 (76%), Positives = 58/65 (89%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 C+ATKSLL + AKYY IELDQVDDG+A+Q ALEEITGQR+VPN+FI +HIGGNS+LQA Sbjct: 28 CRATKSLLDERKAKYYKIELDQVDDGAALQDALEEITGQRSVPNIFIAQEHIGGNSELQA 87 Query: 183 KKSQL 197 KKSQL Sbjct: 88 KKSQL 92 >ref|XP_003299699.1| hypothetical protein PTT_10750 [Pyrenophora teres f. teres 0-1] gi|311326524|gb|EFQ92211.1| hypothetical protein PTT_10750 [Pyrenophora teres f. teres 0-1] Length = 102 Score = 105 bits (261), Expect = 9e-21 Identities = 49/66 (74%), Positives = 56/66 (84%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 C+ K LL+D GAK+YAIELDQVDDGSAMQS L ++TGQ TVPN+FI KHIGGNSDLQA Sbjct: 28 CRQAKQLLTDKGAKFYAIELDQVDDGSAMQSVLGDLTGQTTVPNIFIAQKHIGGNSDLQA 87 Query: 183 KKSQLP 200 KK +LP Sbjct: 88 KKGELP 93 >gb|EXJ81237.1| glutaredoxin 3 [Capronia epimyces CBS 606.96] Length = 102 Score = 104 bits (260), Expect = 1e-20 Identities = 49/65 (75%), Positives = 58/65 (89%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 C+ATKSLLS+ AKYY +ELD+VDDG+A+Q ALEEITGQR+VPN+FI KHIGGNSDLQA Sbjct: 28 CRATKSLLSEKHAKYYLLELDEVDDGAAIQDALEEITGQRSVPNIFIAQKHIGGNSDLQA 87 Query: 183 KKSQL 197 KK +L Sbjct: 88 KKGEL 92 >gb|EXJ63767.1| glutaredoxin 3 [Cladophialophora yegresii CBS 114405] Length = 102 Score = 104 bits (259), Expect = 1e-20 Identities = 48/65 (73%), Positives = 59/65 (90%) Frame = +3 Query: 3 CKATKSLLSDMGAKYYAIELDQVDDGSAMQSALEEITGQRTVPNVFINHKHIGGNSDLQA 182 C+A+K+LL+DM AKY+ +ELDQV+DG+A+Q ALEEITGQR+VPN+FI HIGGNSDLQA Sbjct: 28 CRASKALLNDMHAKYFLMELDQVEDGAALQDALEEITGQRSVPNIFIGQNHIGGNSDLQA 87 Query: 183 KKSQL 197 KKSQL Sbjct: 88 KKSQL 92