BLASTX nr result
ID: Sinomenium22_contig00034783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00034783 (1136 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007208025.1| hypothetical protein PRUPE_ppa003106mg [Prun... 61 8e-07 >ref|XP_007208025.1| hypothetical protein PRUPE_ppa003106mg [Prunus persica] gi|462403667|gb|EMJ09224.1| hypothetical protein PRUPE_ppa003106mg [Prunus persica] Length = 603 Score = 61.2 bits (147), Expect = 8e-07 Identities = 41/92 (44%), Positives = 55/92 (59%), Gaps = 5/92 (5%) Frame = -2 Query: 922 LPIFKVLRQEVQDARMDNGKEISTDSCKRDASQPQ-LCVAKDATLPLPPVL----ASGSN 758 LP K L+ E+ + D GK CK D+S P+ L + D +P P L AS + Sbjct: 500 LPNKKPLQIELLGSTKD-GKHKCVCLCKEDSSLPKALTLTNDDIIPPPVSLELKDASEMD 558 Query: 757 ISDIHKNLQDLCEYNVMLREKLLATQSMLEAL 662 +SD+ KNL+ L EYNVMLREKL+ATQS+ +L Sbjct: 559 MSDVQKNLRSLYEYNVMLREKLIATQSLFHSL 590