BLASTX nr result
ID: Sinomenium22_contig00034627
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00034627 (479 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362375.1| PREDICTED: importin-11-like [Solanum tuberosum] 68 1e-09 ref|XP_004296605.1| PREDICTED: importin-11-like [Fragaria vesca ... 68 1e-09 ref|XP_007225581.1| hypothetical protein PRUPE_ppa023343m1g, par... 68 1e-09 ref|XP_004246776.1| PREDICTED: importin-11-like [Solanum lycoper... 68 1e-09 ref|XP_002262626.2| PREDICTED: importin-11-like [Vitis vinifera] 68 1e-09 emb|CBI18250.3| unnamed protein product [Vitis vinifera] 68 1e-09 ref|XP_002530502.1| importin, putative [Ricinus communis] gi|223... 68 1e-09 gb|EYU41926.1| hypothetical protein MIMGU_mgv1a000736mg [Mimulus... 68 2e-09 gb|EXB62698.1| hypothetical protein L484_023996 [Morus notabilis] 67 3e-09 gb|EPS61178.1| hypothetical protein M569_13621, partial [Genlise... 67 3e-09 ref|XP_004492470.1| PREDICTED: importin-11-like isoform X2 [Cice... 67 3e-09 ref|XP_004492469.1| PREDICTED: importin-11-like isoform X1 [Cice... 67 3e-09 ref|XP_007026643.1| ARM repeat superfamily protein isoform 4 [Th... 65 1e-08 ref|XP_007026642.1| ARM repeat superfamily protein isoform 3 [Th... 65 1e-08 ref|XP_007026641.1| ARM repeat superfamily protein isoform 2 [Th... 65 1e-08 ref|XP_007026640.1| ARM repeat superfamily protein isoform 1 [Th... 65 1e-08 ref|XP_003530293.1| PREDICTED: importin-11-like isoform X1 [Glyc... 65 1e-08 ref|XP_002323597.1| importin beta-2 subunit family protein [Popu... 65 1e-08 ref|XP_006602677.1| PREDICTED: importin-11-like isoform X2 [Glyc... 64 2e-08 ref|XP_006481068.1| PREDICTED: importin-11-like [Citrus sinensis] 64 2e-08 >ref|XP_006362375.1| PREDICTED: importin-11-like [Solanum tuberosum] Length = 1005 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS EL NDHPNMRIIHRK+ALILG+WVSEIK Sbjct: 509 FNGALSLELTNDHPNMRIIHRKVALILGQWVSEIK 543 >ref|XP_004296605.1| PREDICTED: importin-11-like [Fragaria vesca subsp. vesca] Length = 1010 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS EL NDHPNMRIIHRK+ALILG+WVSEIK Sbjct: 509 FNGALSLELSNDHPNMRIIHRKVALILGQWVSEIK 543 >ref|XP_007225581.1| hypothetical protein PRUPE_ppa023343m1g, partial [Prunus persica] gi|462422517|gb|EMJ26780.1| hypothetical protein PRUPE_ppa023343m1g, partial [Prunus persica] Length = 482 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS EL NDHPNMRIIHRK+ALILG+WVSEIK Sbjct: 380 FNGALSLELSNDHPNMRIIHRKVALILGQWVSEIK 414 >ref|XP_004246776.1| PREDICTED: importin-11-like [Solanum lycopersicum] Length = 1005 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS EL NDHPNMRIIHRK+ALILG+WVSEIK Sbjct: 509 FNGALSLELTNDHPNMRIIHRKVALILGQWVSEIK 543 >ref|XP_002262626.2| PREDICTED: importin-11-like [Vitis vinifera] Length = 1011 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS EL NDHPNMRIIHRK+ALILG+WVSEIK Sbjct: 509 FNGALSLELSNDHPNMRIIHRKVALILGQWVSEIK 543 >emb|CBI18250.3| unnamed protein product [Vitis vinifera] Length = 564 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS EL NDHPNMRIIHRK+ALILG+WVSEIK Sbjct: 62 FNGALSLELSNDHPNMRIIHRKVALILGQWVSEIK 96 >ref|XP_002530502.1| importin, putative [Ricinus communis] gi|223529959|gb|EEF31886.1| importin, putative [Ricinus communis] Length = 1011 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS EL NDHPNMRIIHRK+ALILG+WVSEIK Sbjct: 509 FNGALSLELSNDHPNMRIIHRKVALILGQWVSEIK 543 >gb|EYU41926.1| hypothetical protein MIMGU_mgv1a000736mg [Mimulus guttatus] Length = 1000 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS EL NDHPNMRIIHRK+ALILG+WVSEIK Sbjct: 505 FNGALSIELTNDHPNMRIIHRKVALILGQWVSEIK 539 >gb|EXB62698.1| hypothetical protein L484_023996 [Morus notabilis] Length = 983 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS +L NDHPNMRIIHRK+ALILG+WVSEIK Sbjct: 496 FNGALSLDLSNDHPNMRIIHRKVALILGQWVSEIK 530 >gb|EPS61178.1| hypothetical protein M569_13621, partial [Genlisea aurea] Length = 449 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS E+MN+HPNMRI+HRK+ALILG+W+SEIK Sbjct: 329 FNGALSSEVMNNHPNMRIVHRKVALILGQWISEIK 363 >ref|XP_004492470.1| PREDICTED: importin-11-like isoform X2 [Cicer arietinum] Length = 857 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS EL NDHPN+RIIHRK+A+ILG+WVSEIK Sbjct: 356 FNGALSHELSNDHPNLRIIHRKVAVILGQWVSEIK 390 >ref|XP_004492469.1| PREDICTED: importin-11-like isoform X1 [Cicer arietinum] Length = 1009 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS EL NDHPN+RIIHRK+A+ILG+WVSEIK Sbjct: 508 FNGALSHELSNDHPNLRIIHRKVAVILGQWVSEIK 542 >ref|XP_007026643.1| ARM repeat superfamily protein isoform 4 [Theobroma cacao] gi|508715248|gb|EOY07145.1| ARM repeat superfamily protein isoform 4 [Theobroma cacao] Length = 741 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS EL NDHP MRIIHRK+ALILG+WVSEIK Sbjct: 509 FNGALSLELSNDHPIMRIIHRKVALILGQWVSEIK 543 >ref|XP_007026642.1| ARM repeat superfamily protein isoform 3 [Theobroma cacao] gi|508715247|gb|EOY07144.1| ARM repeat superfamily protein isoform 3 [Theobroma cacao] Length = 841 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS EL NDHP MRIIHRK+ALILG+WVSEIK Sbjct: 509 FNGALSLELSNDHPIMRIIHRKVALILGQWVSEIK 543 >ref|XP_007026641.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao] gi|508715246|gb|EOY07143.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao] Length = 968 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS EL NDHP MRIIHRK+ALILG+WVSEIK Sbjct: 509 FNGALSLELSNDHPIMRIIHRKVALILGQWVSEIK 543 >ref|XP_007026640.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao] gi|508715245|gb|EOY07142.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao] Length = 1060 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS EL NDHP MRIIHRK+ALILG+WVSEIK Sbjct: 529 FNGALSLELSNDHPIMRIIHRKVALILGQWVSEIK 563 >ref|XP_003530293.1| PREDICTED: importin-11-like isoform X1 [Glycine max] Length = 1015 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS EL N+HPN+RIIHRK+A+ILG+WVSEIK Sbjct: 508 FNGALSLELSNEHPNLRIIHRKVAIILGQWVSEIK 542 >ref|XP_002323597.1| importin beta-2 subunit family protein [Populus trichocarpa] gi|222868227|gb|EEF05358.1| importin beta-2 subunit family protein [Populus trichocarpa] Length = 962 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS EL NDHPNM +IHRK+ALILG+WVSEIK Sbjct: 467 FNGALSLELSNDHPNMCVIHRKVALILGQWVSEIK 501 >ref|XP_006602677.1| PREDICTED: importin-11-like isoform X2 [Glycine max] Length = 911 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS EL N+HPN+RIIHRK+A+ILG+WVSEIK Sbjct: 410 FNGALSLELSNEHPNLRIIHRKVAVILGQWVSEIK 444 >ref|XP_006481068.1| PREDICTED: importin-11-like [Citrus sinensis] Length = 1011 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 374 FNGALSRELMNDHPNMRIIHRKIALILGEWVSEIK 478 FNGALS +L NDHPNM IIHRK+A+ILG+WVSEIK Sbjct: 509 FNGALSLDLSNDHPNMHIIHRKVAIILGQWVSEIK 543