BLASTX nr result
ID: Sinomenium22_contig00034604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00034604 (642 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004507732.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 56 8e-06 >ref|XP_004507732.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like [Cicer arietinum] Length = 914 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +3 Query: 3 GFCAMCALQNHVKCALQSSGRILAPKDLVMN 95 GFCA+CA+Q HV CALQS+G IL+PKDLV+N Sbjct: 133 GFCALCAIQKHVSCALQSTGSILSPKDLVLN 163