BLASTX nr result
ID: Sinomenium22_contig00034531
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00034531 (884 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT33750.1| Putative chromatin-remodeling complex ATPase chai... 64 8e-08 >gb|EMT33750.1| Putative chromatin-remodeling complex ATPase chain [Aegilops tauschii] Length = 950 Score = 63.9 bits (154), Expect = 8e-08 Identities = 32/50 (64%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = +3 Query: 3 PCDLEVTGSSRRNSLLL-CKVRLRTTNSKWSDPFPGSCIRRSFRHRAAFF 149 PCD EVTGSS NSLLL C+ RLRT + KWSDP P C S+ HRAA F Sbjct: 14 PCDHEVTGSSPGNSLLLKCRERLRTIDPKWSDPSPDPCASGSYMHRAALF 63