BLASTX nr result
ID: Sinomenium22_contig00034468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00034468 (484 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB36980.1| hypothetical protein L484_018358 [Morus notabilis] 42 7e-06 >gb|EXB36980.1| hypothetical protein L484_018358 [Morus notabilis] Length = 601 Score = 42.0 bits (97), Expect(3) = 7e-06 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = +1 Query: 151 GEMAFNMSFPSLYSLSLLHNELISPFICHSNDPIGSLLPWEFHFRQN 291 GE + SF +L+ LS LHN+ IS F ND + + W FHFR+N Sbjct: 276 GEESLAASFSNLFRLSNLHNQAISSFYSIGND---ATISWNFHFRRN 319 Score = 28.1 bits (61), Expect(3) = 7e-06 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 362 IWALDKSRFFNCKSLFHHRIEXXXXXXXXXXXXLWK 469 +W L+ S F+CKSLF+ ++ +WK Sbjct: 349 VWDLEGSGIFSCKSLFNSLVDNQSFPPFPFYYFVWK 384 Score = 24.3 bits (51), Expect(3) = 7e-06 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +3 Query: 99 LGDGSYITCWEDDWFG 146 +G+G + WED+W G Sbjct: 261 IGNGRRVRFWEDEWAG 276