BLASTX nr result
ID: Sinomenium22_contig00034455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00034455 (263 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI40185.3| unnamed protein product [Vitis vinifera] 68 2e-09 ref|XP_002315346.1| transducin family protein [Populus trichocar... 64 2e-08 ref|XP_006491886.1| PREDICTED: probable U3 small nucleolar RNA-a... 57 4e-06 >emb|CBI40185.3| unnamed protein product [Vitis vinifera] Length = 536 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = +2 Query: 122 MGVKQDNRESEVIVPSGEQDVSDELDSKVKKYLRGNGADLESLQDKK 262 MGV+Q+N +VP+ EQD+SDELD KVKKYLRG GA+LE+LQDKK Sbjct: 1 MGVEQENGTPTEMVPASEQDISDELDVKVKKYLRGEGANLEALQDKK 47 >ref|XP_002315346.1| transducin family protein [Populus trichocarpa] gi|222864386|gb|EEF01517.1| transducin family protein [Populus trichocarpa] Length = 537 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = +2 Query: 122 MGVKQDNRESEVIVPSGEQDVSDELDSKVKKYLRGNGADLESLQDKK 262 MG KQ+N + E I+P EQ++S ELD KVKKYLRG GADLE L+DKK Sbjct: 1 MGAKQENGDPEDILPPPEQELSHELDMKVKKYLRGEGADLEVLKDKK 47 >ref|XP_006491886.1| PREDICTED: probable U3 small nucleolar RNA-associated protein 7-like [Citrus sinensis] Length = 537 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +2 Query: 122 MGVKQDNRESEVIVPSGEQDVSDELDSKVKKYLRGNGADLESLQDKK 262 MG K++N + I P EQ++S+ELD+ VKKYLRG GA+LE L+DKK Sbjct: 1 MGAKEENGDGGGIWPPIEQEISNELDTNVKKYLRGEGANLEILKDKK 47