BLASTX nr result
ID: Sinomenium22_contig00034091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00034091 (502 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD59438.1| Rps16 protein [Clivia gardenii] 57 2e-06 >emb|CAD59438.1| Rps16 protein [Clivia gardenii] Length = 74 Score = 57.0 bits (136), Expect(2) = 2e-06 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +2 Query: 212 VGFK*IVHDGARVERIDSFFRGKDLGLVSINKLEQLRKYIAN 337 V K IVHDGAR + IDSF GK+LGLV+INKL+QL KYI N Sbjct: 20 VNRKGIVHDGARTKSIDSFIGGKNLGLVTINKLDQLCKYILN 61 Score = 20.8 bits (42), Expect(2) = 2e-06 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 166 SWLDIVCSVLFETLFC 213 S +DIVCSV L C Sbjct: 1 SRIDIVCSVPARNLIC 16