BLASTX nr result
ID: Sinomenium22_contig00033952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00033952 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007136590.1| hypothetical protein PHAVU_009G057700g [Phas... 56 5e-06 ref|XP_006587089.1| PREDICTED: DUF21 domain-containing protein A... 56 6e-06 ref|XP_006581210.1| PREDICTED: DUF21 domain-containing protein A... 56 6e-06 ref|XP_003523834.1| PREDICTED: DUF21 domain-containing protein A... 56 6e-06 gb|ACU16963.1| unknown [Glycine max] 56 6e-06 ref|XP_004501016.1| PREDICTED: DUF21 domain-containing protein A... 55 8e-06 ref|XP_004501015.1| PREDICTED: DUF21 domain-containing protein A... 55 8e-06 >ref|XP_007136590.1| hypothetical protein PHAVU_009G057700g [Phaseolus vulgaris] gi|561009677|gb|ESW08584.1| hypothetical protein PHAVU_009G057700g [Phaseolus vulgaris] Length = 489 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 264 MATDVACCGTKFSLYVIAIVGLVCFAGLMA 353 MA ++ CCGTKFSLYV+ IVGLVCFAGLMA Sbjct: 1 MAAEIPCCGTKFSLYVLVIVGLVCFAGLMA 30 >ref|XP_006587089.1| PREDICTED: DUF21 domain-containing protein At1g47330-like [Glycine max] Length = 200 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 264 MATDVACCGTKFSLYVIAIVGLVCFAGLMA 353 MA ++ CCGTKFSLYV+ I+GLVCFAGLMA Sbjct: 1 MAAEIPCCGTKFSLYVLVIIGLVCFAGLMA 30 >ref|XP_006581210.1| PREDICTED: DUF21 domain-containing protein At1g47330-like [Glycine max] Length = 487 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 264 MATDVACCGTKFSLYVIAIVGLVCFAGLMA 353 MA ++ CCGTKFSLYV+ I+GLVCFAGLMA Sbjct: 1 MAAEIPCCGTKFSLYVLVIIGLVCFAGLMA 30 >ref|XP_003523834.1| PREDICTED: DUF21 domain-containing protein At1g47330 [Glycine max] Length = 487 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 264 MATDVACCGTKFSLYVIAIVGLVCFAGLMA 353 MA ++ CCGTKFSLYV+ I+GLVCFAGLMA Sbjct: 1 MAAEIPCCGTKFSLYVLVIIGLVCFAGLMA 30 >gb|ACU16963.1| unknown [Glycine max] Length = 214 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 264 MATDVACCGTKFSLYVIAIVGLVCFAGLMA 353 MA ++ CCGTKFSLYV+ I+GLVCFAGLMA Sbjct: 1 MAAEIPCCGTKFSLYVLVIIGLVCFAGLMA 30 >ref|XP_004501016.1| PREDICTED: DUF21 domain-containing protein At1g47330-like isoform X2 [Cicer arietinum] Length = 483 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 264 MATDVACCGTKFSLYVIAIVGLVCFAGLMA 353 MA DV CCGTKF LY+I IVGLVCFAGLMA Sbjct: 1 MAADVGCCGTKFWLYLIVIVGLVCFAGLMA 30 >ref|XP_004501015.1| PREDICTED: DUF21 domain-containing protein At1g47330-like isoform X1 [Cicer arietinum] Length = 492 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 264 MATDVACCGTKFSLYVIAIVGLVCFAGLMA 353 MA DV CCGTKF LY+I IVGLVCFAGLMA Sbjct: 1 MAADVGCCGTKFWLYLIVIVGLVCFAGLMA 30