BLASTX nr result
ID: Sinomenium22_contig00033920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00033920 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004301329.1| PREDICTED: uncharacterized protein LOC101296... 52 1e-06 >ref|XP_004301329.1| PREDICTED: uncharacterized protein LOC101296391 [Fragaria vesca subsp. vesca] Length = 323 Score = 52.0 bits (123), Expect(2) = 1e-06 Identities = 30/63 (47%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Frame = -3 Query: 326 GRGRDQNLGRGRSYSHIN-SPSSLSASQTCSTCQICNRTKHTDLVCYHRMDHFY*GRTPP 150 GRG N GRG S + S SSL +Q TCQIC++T HT L CY+R++ + GR P Sbjct: 150 GRGFPLNRGRGASVLGPHPSSSSLFNNQARPTCQICSKTGHTALDCYNRLNLSFQGRVPS 209 Query: 149 LNL 141 NL Sbjct: 210 RNL 212 Score = 26.2 bits (56), Expect(2) = 1e-06 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 87 SRATNHMKNDLGNLSLCFEYSGTNHV 10 S A +H+ +DLGNL EY G + V Sbjct: 231 SGANSHITSDLGNLQNPKEYQGNDRV 256