BLASTX nr result
ID: Sinomenium22_contig00033675
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00033675 (549 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB97147.1| hypothetical protein L484_008637 [Morus notabilis] 42 1e-06 ref|XP_002305013.1| hypothetical protein POPTR_0004s03860g [Popu... 43 3e-06 ref|XP_002317226.1| hydroxyproline-rich glycoprotein [Populus tr... 40 5e-06 >gb|EXB97147.1| hypothetical protein L484_008637 [Morus notabilis] Length = 669 Score = 42.4 bits (98), Expect(2) = 1e-06 Identities = 19/45 (42%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Frame = -1 Query: 507 GLTRDYSCEWGENFLLVVELQK-VLTLRDIFDLPPCNGN*YIKEV 376 G+ + C W + +L++EL+K +LT RD DLPPC+G+ I E+ Sbjct: 3 GIAKGNLCGWTGSLILMIELRKKILTFRDTIDLPPCDGSSPIHEL 47 Score = 35.8 bits (81), Expect(2) = 1e-06 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = -3 Query: 256 SVSIMQLLLGTVEDLHKLYPKIVPKTR 176 S I +L+ GTVEDLH LYP IVP R Sbjct: 41 SSPIHELVKGTVEDLHNLYPNIVPYDR 67 >ref|XP_002305013.1| hypothetical protein POPTR_0004s03860g [Populus trichocarpa] gi|222847977|gb|EEE85524.1| hypothetical protein POPTR_0004s03860g [Populus trichocarpa] Length = 788 Score = 42.7 bits (99), Expect(2) = 3e-06 Identities = 16/30 (53%), Positives = 26/30 (86%) Frame = -3 Query: 256 SVSIMQLLLGTVEDLHKLYPKIVPKTRLYQ 167 S+SI +L++GT+ DLHK YP+I+P ++LY+ Sbjct: 67 SLSINELVMGTMRDLHKFYPEIIPSSQLYE 96 Score = 33.9 bits (76), Expect(2) = 3e-06 Identities = 16/33 (48%), Positives = 25/33 (75%), Gaps = 1/33 (3%) Frame = -1 Query: 471 NFLLVVELQK-VLTLRDIFDLPPCNGN*YIKEV 376 NF+L++EL+K ++T RDI DLPP + + I E+ Sbjct: 41 NFILMMELRKKIITFRDIIDLPPFDASLSINEL 73 >ref|XP_002317226.1| hydroxyproline-rich glycoprotein [Populus trichocarpa] gi|222860291|gb|EEE97838.1| hydroxyproline-rich glycoprotein [Populus trichocarpa] Length = 792 Score = 39.7 bits (91), Expect(2) = 5e-06 Identities = 15/28 (53%), Positives = 25/28 (89%) Frame = -3 Query: 256 SVSIMQLLLGTVEDLHKLYPKIVPKTRL 173 S+SI +L++GT++DLHK YP+I+P ++L Sbjct: 38 SLSINELVMGTMKDLHKFYPEIIPSSQL 65 Score = 36.2 bits (82), Expect(2) = 5e-06 Identities = 17/33 (51%), Positives = 26/33 (78%), Gaps = 1/33 (3%) Frame = -1 Query: 471 NFLLVVELQK-VLTLRDIFDLPPCNGN*YIKEV 376 NF+L++EL+K ++T RDI DLPP +G+ I E+ Sbjct: 12 NFILMMELRKKIITFRDIIDLPPFDGSLSINEL 44