BLASTX nr result
ID: Sinomenium22_contig00033559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00033559 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC07286.1| hypothetical protein L484_021193 [Morus notabilis] 55 8e-06 >gb|EXC07286.1| hypothetical protein L484_021193 [Morus notabilis] Length = 648 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +2 Query: 23 KTGVYLDPEQYTIDHMPVDAMRGEILRACRA 115 KTGVYL PE+YT++HMP+D MRGEI ACR+ Sbjct: 618 KTGVYLGPERYTLEHMPIDVMRGEIFNACRS 648