BLASTX nr result
ID: Sinomenium22_contig00033555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00033555 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632060.1| PREDICTED: uncharacterized protein LOC100854... 55 8e-06 >ref|XP_003632060.1| PREDICTED: uncharacterized protein LOC100854122 [Vitis vinifera] Length = 431 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/36 (58%), Positives = 31/36 (86%) Frame = -2 Query: 157 GSGPSRGRLWPKVVVAMAVLLLSYNVGSVSGDPYVY 50 G GPSRGRLWP+++VA+A+++++ NVGS DPY+Y Sbjct: 5 GGGPSRGRLWPQILVALALVVVASNVGSTHADPYIY 40