BLASTX nr result
ID: Sinomenium22_contig00033366
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00033366 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006474246.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_006372189.1| cytochrome P450 71B10 family protein [Populu... 57 3e-06 >ref|XP_006474246.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X1 [Citrus sinensis] gi|568840585|ref|XP_006474247.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X2 [Citrus sinensis] Length = 1074 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/57 (52%), Positives = 41/57 (71%) Frame = +1 Query: 160 LTRKISSSKSPQNLSKTLSLQNLLKSGFSPTLETFHRFLLYLSKAHKIGFLLHFFSQ 330 +TR SSS SP N KT S Q L+K GF+PTL + ++FLL+LS+ + F++HFFSQ Sbjct: 3 MTRSFSSS-SPCNHPKTSSFQTLIKRGFTPTLNSINKFLLWLSQNKRFNFVIHFFSQ 58 >ref|XP_006372189.1| cytochrome P450 71B10 family protein [Populus trichocarpa] gi|550318714|gb|ERP49986.1| cytochrome P450 71B10 family protein [Populus trichocarpa] Length = 1075 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = +1 Query: 181 SKSPQNLSKTLSLQNLLKSGFSPTLETFHRFLLYLSKAHKIGFLLHFFSQ 330 S SP + S + S+Q LLKSGFSPTL++ ++FL +LSK+HK + HFF Q Sbjct: 2 SFSPSSSSSSSSVQTLLKSGFSPTLKSINQFLHFLSKSHKYELITHFFCQ 51