BLASTX nr result
ID: Sinomenium22_contig00032205
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00032205 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007029679.1| Chaperone DnaJ-domain superfamily protein is... 58 1e-06 >ref|XP_007029679.1| Chaperone DnaJ-domain superfamily protein isoform 1 [Theobroma cacao] gi|508718284|gb|EOY10181.1| Chaperone DnaJ-domain superfamily protein isoform 1 [Theobroma cacao] Length = 123 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -3 Query: 335 FKGMILTCNGLGIDHVSIWTQQPTETKDCVDK 240 FKGMILTCNGLGI H SIWTQQ TET D VD+ Sbjct: 92 FKGMILTCNGLGISHTSIWTQQLTETNDFVDE 123