BLASTX nr result
ID: Sinomenium22_contig00032080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00032080 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004515858.1| PREDICTED: cytochrome P450 71A1-like [Cicer ... 60 3e-07 >ref|XP_004515858.1| PREDICTED: cytochrome P450 71A1-like [Cicer arietinum] Length = 520 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -3 Query: 337 LYWFDWELPDDDTNYKDGLDMTEDFGIGLGRKTPLHLAPILHF 209 LYWFDW+LP+ D +D LDM+E FG+ + RK PLH+ PILHF Sbjct: 477 LYWFDWKLPETDLGTQD-LDMSEVFGLVVSRKKPLHIKPILHF 518