BLASTX nr result
ID: Sinomenium22_contig00031389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00031389 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGH32912.1| biotin carboxyl carrier protein subunit [Camellia... 66 4e-09 gb|EYU39717.1| hypothetical protein MIMGU_mgv1a011080mg [Mimulus... 66 6e-09 ref|XP_002514825.1| Biotin carboxyl carrier protein subunit of o... 66 6e-09 ref|XP_002284374.1| PREDICTED: biotin carboxyl carrier protein o... 65 8e-09 gb|AGB07441.1| biotin carboxyl carrier protein [Persea americana] 65 1e-08 gb|ACO53610.1| biotin carboxyl carrier protein 1-2 [Arachis hypo... 65 1e-08 gb|ACO53609.1| biotin carboxyl carrier protein 1-1 [Arachis hypo... 65 1e-08 ref|XP_004493036.1| PREDICTED: biotin carboxyl carrier protein o... 64 2e-08 ref|XP_004241599.1| PREDICTED: biotin carboxyl carrier protein o... 64 2e-08 gb|ACO53615.1| biotin carboxyl carrier protein 2-5 [Arachis hypo... 64 2e-08 gb|ACO53614.1| biotin carboxyl carrier protein 2-4 [Arachis hypo... 64 2e-08 gb|ACO53613.1| biotin carboxyl carrier protein 2-3 [Arachis hypo... 64 2e-08 gb|ACO53612.1| biotin carboxyl carrier protein 2-2 [Arachis hypo... 64 2e-08 gb|ACO53611.1| biotin carboxyl carrier protein 2-1 [Arachis hypo... 64 2e-08 gb|EYU39465.1| hypothetical protein MIMGU_mgv1a011231mg [Mimulus... 64 3e-08 ref|XP_006354759.1| PREDICTED: biotin carboxyl carrier protein o... 64 3e-08 ref|XP_007139713.1| hypothetical protein PHAVU_008G053000g [Phas... 64 3e-08 ref|XP_007029254.1| Biotin carboxyl carrier protein subunit of o... 64 3e-08 ref|XP_007029252.1| Biotin carboxyl carrier protein subunit of o... 64 3e-08 gb|ACN85391.1| acetyl-coenzyme A carboxylase [Suaeda salsa] 64 3e-08 >gb|AGH32912.1| biotin carboxyl carrier protein subunit [Camellia chekiangoleosa] Length = 283 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQSG +VEI+ EDGKPVS+DTPL +IEP Sbjct: 247 MKLMNEIEADQSGTVVEIIAEDGKPVSVDTPLFVIEP 283 >gb|EYU39717.1| hypothetical protein MIMGU_mgv1a011080mg [Mimulus guttatus] gi|604335830|gb|EYU39718.1| hypothetical protein MIMGU_mgv1a011080mg [Mimulus guttatus] Length = 293 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQSG +VEIL EDGKPVS+DTPL +IEP Sbjct: 257 MKLMNEIEADQSGTLVEILGEDGKPVSIDTPLFVIEP 293 >ref|XP_002514825.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1) [Ricinus communis] gi|223545876|gb|EEF47379.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1) [Ricinus communis] Length = 315 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQSG IVE L+EDGKPVS+DTPL +IEP Sbjct: 279 MKLMNEIEADQSGTIVEALLEDGKPVSVDTPLFVIEP 315 >ref|XP_002284374.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic [Vitis vinifera] gi|296082996|emb|CBI22297.3| unnamed protein product [Vitis vinifera] Length = 270 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQSG I EIL EDGKPVS+DTPLL+I P Sbjct: 234 MKLMNEIEADQSGTIAEILAEDGKPVSIDTPLLVIAP 270 >gb|AGB07441.1| biotin carboxyl carrier protein [Persea americana] Length = 281 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQSG IVEIL ED KPVS+DTPL +IEP Sbjct: 245 MKLMNEIEADQSGTIVEILAEDAKPVSVDTPLFVIEP 281 >gb|ACO53610.1| biotin carboxyl carrier protein 1-2 [Arachis hypogaea] Length = 279 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQSG IVEIL EDGKPVS+D PL +IEP Sbjct: 243 MKLMNEIEADQSGTIVEILAEDGKPVSVDMPLFVIEP 279 >gb|ACO53609.1| biotin carboxyl carrier protein 1-1 [Arachis hypogaea] Length = 279 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQSG IVEIL EDGKPVS+D PL +IEP Sbjct: 243 MKLMNEIEADQSGTIVEILAEDGKPVSVDMPLFVIEP 279 >ref|XP_004493036.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like [Cicer arietinum] Length = 260 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQSG IVEI+ ED KPVS+DTPL +IEP Sbjct: 224 MKLMNEIEADQSGTIVEIVAEDAKPVSVDTPLFVIEP 260 >ref|XP_004241599.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like [Solanum lycopersicum] Length = 261 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQ+G IV+I+ EDGKPVS+DTPL +IEP Sbjct: 225 MKLMNEIEADQAGTIVDIVAEDGKPVSVDTPLFVIEP 261 >gb|ACO53615.1| biotin carboxyl carrier protein 2-5 [Arachis hypogaea] Length = 276 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQ+G I EIL EDGKPVS+DTPLL+I P Sbjct: 240 MKLMNEIEADQTGTITEILAEDGKPVSVDTPLLVIAP 276 >gb|ACO53614.1| biotin carboxyl carrier protein 2-4 [Arachis hypogaea] Length = 276 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQ+G I EIL EDGKPVS+DTPLL+I P Sbjct: 240 MKLMNEIEADQTGTITEILAEDGKPVSVDTPLLVIAP 276 >gb|ACO53613.1| biotin carboxyl carrier protein 2-3 [Arachis hypogaea] Length = 276 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQ+G I EIL EDGKPVS+DTPLL+I P Sbjct: 240 MKLMNEIEADQTGTITEILAEDGKPVSVDTPLLVIAP 276 >gb|ACO53612.1| biotin carboxyl carrier protein 2-2 [Arachis hypogaea] Length = 276 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQ+G I EIL EDGKPVS+DTPLL+I P Sbjct: 240 MKLMNEIEADQTGTITEILAEDGKPVSVDTPLLVIAP 276 >gb|ACO53611.1| biotin carboxyl carrier protein 2-1 [Arachis hypogaea] Length = 276 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQ+G I EIL EDGKPVS+DTPLL+I P Sbjct: 240 MKLMNEIEADQTGTITEILAEDGKPVSVDTPLLVIAP 276 >gb|EYU39465.1| hypothetical protein MIMGU_mgv1a011231mg [Mimulus guttatus] Length = 288 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIE+D+SG IVEI+ EDGKPVS+DTPL +IEP Sbjct: 252 MKLMNEIESDRSGTIVEIVAEDGKPVSVDTPLFVIEP 288 >ref|XP_006354759.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like [Solanum tuberosum] Length = 258 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQ+G +V+I+ EDGKPVS+DTPL +IEP Sbjct: 222 MKLMNEIEADQAGTVVDIVAEDGKPVSVDTPLFVIEP 258 >ref|XP_007139713.1| hypothetical protein PHAVU_008G053000g [Phaseolus vulgaris] gi|561012846|gb|ESW11707.1| hypothetical protein PHAVU_008G053000g [Phaseolus vulgaris] Length = 262 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEA++SG IVEIL ED KPVSLDTPL +IEP Sbjct: 226 MKLMNEIEAEESGTIVEILAEDAKPVSLDTPLFVIEP 262 >ref|XP_007029254.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 3 [Theobroma cacao] gi|508717859|gb|EOY09756.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 3 [Theobroma cacao] Length = 310 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQSG IVEILVEDGK VS+D PL +IEP Sbjct: 274 MKLMNEIEADQSGTIVEILVEDGKSVSVDMPLFVIEP 310 >ref|XP_007029252.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 1 [Theobroma cacao] gi|508717857|gb|EOY09754.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 1 [Theobroma cacao] Length = 279 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQSG IVEILVEDGK VS+D PL +IEP Sbjct: 243 MKLMNEIEADQSGTIVEILVEDGKSVSVDMPLFVIEP 279 >gb|ACN85391.1| acetyl-coenzyme A carboxylase [Suaeda salsa] Length = 257 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 382 MKLMNEIEADQSGKIVEILVEDGKPVSLDTPLLIIEP 272 MKLMNEIEADQSG IVEIL +DGKPVS+D PL +IEP Sbjct: 221 MKLMNEIEADQSGTIVEILAKDGKPVSVDMPLFVIEP 257