BLASTX nr result
ID: Sinomenium22_contig00031202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00031202 (493 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62570.1| hypothetical protein VITISV_029090 [Vitis vinifera] 60 3e-07 ref|XP_002273309.1| PREDICTED: F-box protein SKIP24 [Vitis vinif... 60 4e-07 >emb|CAN62570.1| hypothetical protein VITISV_029090 [Vitis vinifera] Length = 256 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -1 Query: 493 RDEKQRLDAVKKQLGLMKYHPLRDYPLLETGVNCCQNQRKKLKQ 362 R+EK+RLDA K++L +MKYHPLRDY +GV+ C +QRKKLK+ Sbjct: 194 RNEKRRLDAAKERLVIMKYHPLRDYKSTSSGVDECNSQRKKLKR 237 >ref|XP_002273309.1| PREDICTED: F-box protein SKIP24 [Vitis vinifera] gi|296085868|emb|CBI31192.3| unnamed protein product [Vitis vinifera] Length = 256 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -1 Query: 493 RDEKQRLDAVKKQLGLMKYHPLRDYPLLETGVNCCQNQRKKLKQ 362 R+EK+RLDA K++L +MKYHPLRDY +GV+ C +QRKKLK+ Sbjct: 194 RNEKRRLDAAKERLVVMKYHPLRDYKSTSSGVDECNSQRKKLKR 237