BLASTX nr result
ID: Sinomenium22_contig00030238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00030238 (761 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006468886.1| PREDICTED: putative pentatricopeptide repeat... 98 3e-18 ref|XP_006446942.1| hypothetical protein CICLE_v10014272mg [Citr... 98 3e-18 ref|XP_002263197.2| PREDICTED: putative pentatricopeptide repeat... 96 2e-17 emb|CBI38188.3| unnamed protein product [Vitis vinifera] 96 2e-17 emb|CAN71462.1| hypothetical protein VITISV_018656 [Vitis vinifera] 96 2e-17 ref|XP_006353946.1| PREDICTED: putative pentatricopeptide repeat... 95 2e-17 ref|XP_004235394.1| PREDICTED: putative pentatricopeptide repeat... 95 2e-17 gb|AAU90328.2| Pentatricopeptide repeat domain containing protei... 95 2e-17 ref|XP_004493071.1| PREDICTED: putative pentatricopeptide repeat... 95 3e-17 ref|XP_003633777.1| PREDICTED: putative pentatricopeptide repeat... 95 3e-17 emb|CBI21281.3| unnamed protein product [Vitis vinifera] 95 3e-17 ref|XP_002303012.2| pentatricopeptide repeat-containing family p... 94 4e-17 ref|XP_007032019.1| Pentatricopeptide repeat (PPR) superfamily p... 94 4e-17 ref|XP_003532067.1| PREDICTED: pentatricopeptide repeat-containi... 94 7e-17 ref|XP_003624492.1| Pentatricopeptide repeat-containing protein ... 94 7e-17 ref|XP_002324099.1| hypothetical protein POPTR_0017s12720g [Popu... 94 7e-17 ref|XP_007161628.1| hypothetical protein PHAVU_001G085300g [Phas... 93 1e-16 ref|XP_002967546.1| hypothetical protein SELMODRAFT_88678 [Selag... 93 1e-16 ref|XP_002981798.1| hypothetical protein SELMODRAFT_115031 [Sela... 93 1e-16 ref|XP_003553304.1| PREDICTED: putative pentatricopeptide repeat... 92 2e-16 >ref|XP_006468886.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510-like [Citrus sinensis] Length = 828 Score = 98.2 bits (243), Expect = 3e-18 Identities = 41/56 (73%), Positives = 47/56 (83%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TP GSPILVMKNLR C DCH AIK IS +TGR++TVRD+ RFHHF+ G CSCRD+W Sbjct: 773 TPEGSPILVMKNLRACTDCHAAIKLISKITGREITVRDSSRFHHFKDGFCSCRDFW 828 >ref|XP_006446942.1| hypothetical protein CICLE_v10014272mg [Citrus clementina] gi|557549553|gb|ESR60182.1| hypothetical protein CICLE_v10014272mg [Citrus clementina] Length = 830 Score = 98.2 bits (243), Expect = 3e-18 Identities = 41/56 (73%), Positives = 47/56 (83%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TP GSPILVMKNLR C DCH AIK IS +TGR++TVRD+ RFHHF+ G CSCRD+W Sbjct: 775 TPEGSPILVMKNLRACTDCHAAIKLISKITGREITVRDSSRFHHFKDGFCSCRDFW 830 >ref|XP_002263197.2| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial-like [Vitis vinifera] Length = 611 Score = 95.5 bits (236), Expect = 2e-17 Identities = 41/56 (73%), Positives = 45/56 (80%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TPSGSPI +MKNLRICVDCH AIKCIS V R++ VRD RFHHF+ G CSC DYW Sbjct: 556 TPSGSPIRIMKNLRICVDCHAAIKCISKVVQREIVVRDINRFHHFQEGLCSCGDYW 611 >emb|CBI38188.3| unnamed protein product [Vitis vinifera] Length = 744 Score = 95.5 bits (236), Expect = 2e-17 Identities = 41/56 (73%), Positives = 45/56 (80%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TPSGSPI +MKNLRICVDCH AIKCIS V R++ VRD RFHHF+ G CSC DYW Sbjct: 689 TPSGSPIRIMKNLRICVDCHAAIKCISKVVQREIVVRDINRFHHFQEGLCSCGDYW 744 >emb|CAN71462.1| hypothetical protein VITISV_018656 [Vitis vinifera] Length = 787 Score = 95.5 bits (236), Expect = 2e-17 Identities = 41/56 (73%), Positives = 45/56 (80%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TPSGSPI +MKNLRICVDCH AIKCIS V R++ VRD RFHHF+ G CSC DYW Sbjct: 732 TPSGSPIRIMKNLRICVDCHAAIKCISKVVQREIVVRDINRFHHFQEGLCSCGDYW 787 >ref|XP_006353946.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510-like [Solanum tuberosum] Length = 819 Score = 95.1 bits (235), Expect = 2e-17 Identities = 39/56 (69%), Positives = 45/56 (80%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TP GSPI++MKNLR CVDCH AIK IS + GR++TVRD+ RFHHF G CSC DYW Sbjct: 764 TPEGSPIIIMKNLRACVDCHAAIKVISKIVGREITVRDSSRFHHFRDGSCSCGDYW 819 >ref|XP_004235394.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510-like [Solanum lycopersicum] Length = 819 Score = 95.1 bits (235), Expect = 2e-17 Identities = 39/56 (69%), Positives = 45/56 (80%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TP GSPI++MKNLR CVDCH AIK IS + GR++TVRD+ RFHHF G CSC DYW Sbjct: 764 TPEGSPIIIMKNLRACVDCHAAIKVISKIVGREITVRDSSRFHHFRDGSCSCGDYW 819 >gb|AAU90328.2| Pentatricopeptide repeat domain containing protein, putative [Solanum demissum] Length = 819 Score = 95.1 bits (235), Expect = 2e-17 Identities = 39/56 (69%), Positives = 45/56 (80%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TP GSPI++MKNLR CVDCH AIK IS + GR++TVRD+ RFHHF G CSC DYW Sbjct: 764 TPEGSPIIIMKNLRACVDCHAAIKVISKIVGREITVRDSSRFHHFRDGSCSCGDYW 819 >ref|XP_004493071.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510-like [Cicer arietinum] Length = 812 Score = 94.7 bits (234), Expect = 3e-17 Identities = 40/56 (71%), Positives = 44/56 (78%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TP GSPILVMKNLR C DCH AIK IS + R++TVRD+ RFHHF G CSCRDYW Sbjct: 757 TPEGSPILVMKNLRACTDCHAAIKVISKIVDREITVRDSSRFHHFRDGFCSCRDYW 812 >ref|XP_003633777.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510-like, partial [Vitis vinifera] Length = 825 Score = 94.7 bits (234), Expect = 3e-17 Identities = 39/56 (69%), Positives = 45/56 (80%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TP GSPILVMKNLR C+DCH AIK IS + GR++TVRD+ RFHHF G CSC D+W Sbjct: 770 TPEGSPILVMKNLRACIDCHAAIKVISKIVGREITVRDSTRFHHFRDGFCSCGDFW 825 >emb|CBI21281.3| unnamed protein product [Vitis vinifera] Length = 785 Score = 94.7 bits (234), Expect = 3e-17 Identities = 39/56 (69%), Positives = 45/56 (80%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TP GSPILVMKNLR C+DCH AIK IS + GR++TVRD+ RFHHF G CSC D+W Sbjct: 730 TPEGSPILVMKNLRACIDCHAAIKVISKIVGREITVRDSTRFHHFRDGFCSCGDFW 785 >ref|XP_002303012.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550345695|gb|EEE82285.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 814 Score = 94.4 bits (233), Expect = 4e-17 Identities = 40/56 (71%), Positives = 44/56 (78%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TP GSPILVMKNLR C DCH AIK IS + GR++TVRD+ RFHHF G CSC DYW Sbjct: 759 TPEGSPILVMKNLRACTDCHAAIKVISKIVGREITVRDSNRFHHFRDGSCSCGDYW 814 >ref|XP_007032019.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508711048|gb|EOY02945.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 818 Score = 94.4 bits (233), Expect = 4e-17 Identities = 40/56 (71%), Positives = 45/56 (80%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TP GSPILVMKNLR C DCH AIK IS + GR++TVRD+ RFHHF+ G CSC DYW Sbjct: 763 TPEGSPILVMKNLRACTDCHAAIKVISKIVGREITVRDSSRFHHFKDGICSCGDYW 818 >ref|XP_003532067.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49710-like [Glycine max] Length = 722 Score = 93.6 bits (231), Expect = 7e-17 Identities = 40/56 (71%), Positives = 46/56 (82%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 T G PILV+KNLRIC DCH A+K IS +TGR++TVRDT RFH F+ GHCSCRDYW Sbjct: 667 TEEGVPILVVKNLRICGDCHNAVKLISALTGREITVRDTHRFHCFKEGHCSCRDYW 722 >ref|XP_003624492.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355499507|gb|AES80710.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1125 Score = 93.6 bits (231), Expect = 7e-17 Identities = 41/63 (65%), Positives = 48/63 (76%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW*TEI 581 TP GSPILVMKNLR C DCH AIK IS + R++TVRD+ RFHHF G C+CRDYW + Sbjct: 819 TPEGSPILVMKNLRACTDCHAAIKVISKIVRREITVRDSSRFHHFRDGFCTCRDYW---V 875 Query: 580 KYL 572 +YL Sbjct: 876 QYL 878 >ref|XP_002324099.1| hypothetical protein POPTR_0017s12720g [Populus trichocarpa] gi|222867101|gb|EEF04232.1| hypothetical protein POPTR_0017s12720g [Populus trichocarpa] Length = 676 Score = 93.6 bits (231), Expect = 7e-17 Identities = 40/56 (71%), Positives = 45/56 (80%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TP G+PI V KNLR CVDCHTAIK IS +T R++ VRD+ RFH FE GHCSCRDYW Sbjct: 621 TPEGTPIKVFKNLRTCVDCHTAIKFISKITNRKIIVRDSNRFHFFEDGHCSCRDYW 676 >ref|XP_007161628.1| hypothetical protein PHAVU_001G085300g [Phaseolus vulgaris] gi|561035092|gb|ESW33622.1| hypothetical protein PHAVU_001G085300g [Phaseolus vulgaris] Length = 862 Score = 92.8 bits (229), Expect = 1e-16 Identities = 39/56 (69%), Positives = 44/56 (78%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TP GSPILVMKNLR C DCH AIK IS + R++TVRD+ RFHHF G CSC+DYW Sbjct: 807 TPEGSPILVMKNLRACNDCHAAIKVISKIVNREITVRDSSRFHHFRDGSCSCKDYW 862 >ref|XP_002967546.1| hypothetical protein SELMODRAFT_88678 [Selaginella moellendorffii] gi|300164284|gb|EFJ30893.1| hypothetical protein SELMODRAFT_88678 [Selaginella moellendorffii] Length = 281 Score = 92.8 bits (229), Expect = 1e-16 Identities = 38/56 (67%), Positives = 46/56 (82%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TPSG+P+ V+KNLR+C DCHTA K IS +TGRQ+TVRD RFH F+ G CSC+DYW Sbjct: 226 TPSGTPLRVVKNLRVCTDCHTATKFISKITGRQITVRDANRFHEFKDGFCSCKDYW 281 >ref|XP_002981798.1| hypothetical protein SELMODRAFT_115031 [Selaginella moellendorffii] gi|300150630|gb|EFJ17280.1| hypothetical protein SELMODRAFT_115031 [Selaginella moellendorffii] Length = 483 Score = 92.8 bits (229), Expect = 1e-16 Identities = 38/56 (67%), Positives = 46/56 (82%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TPSG+P+ V+KNLR+C DCHTA K IS +TGRQ+TVRD RFH F+ G CSC+DYW Sbjct: 428 TPSGTPLRVVKNLRVCTDCHTATKFISKITGRQITVRDANRFHEFKDGFCSCKDYW 483 >ref|XP_003553304.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510-like [Glycine max] Length = 815 Score = 92.4 bits (228), Expect = 2e-16 Identities = 39/56 (69%), Positives = 44/56 (78%) Frame = -2 Query: 760 TPSGSPILVMKNLRICVDCHTAIKCISLVTGRQVTVRDTLRFHHFEHGHCSCRDYW 593 TP GSPILVMKNLR C DCH AIK IS + R++TVRD+ RFHHF G CSC+DYW Sbjct: 760 TPKGSPILVMKNLRACNDCHAAIKVISKIVNREITVRDSSRFHHFTDGSCSCKDYW 815