BLASTX nr result
ID: Sinomenium22_contig00029431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00029431 (293 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004144851.1| PREDICTED: SKP1-like protein 1B-like [Cucumi... 82 8e-14 ref|XP_002531150.1| skp1, putative [Ricinus communis] gi|2235292... 81 1e-13 ref|XP_007156190.1| hypothetical protein PHAVU_003G265900g [Phas... 80 3e-13 ref|XP_006422586.1| hypothetical protein CICLE_v10029465mg [Citr... 80 3e-13 ref|XP_002537506.1| skp1, putative [Ricinus communis] gi|2235160... 80 3e-13 gb|AAD34458.1| Skp1 [Medicago sativa] 80 4e-13 ref|XP_002510576.1| skp1, putative [Ricinus communis] gi|2235512... 80 4e-13 gb|ACJ86090.1| unknown [Medicago truncatula] 80 4e-13 ref|XP_003612225.1| SKP1-like protein [Medicago truncatula] gi|1... 80 4e-13 ref|XP_003612227.1| SKP1-like protein [Medicago truncatula] gi|1... 80 4e-13 ref|XP_002510577.1| skp1, putative [Ricinus communis] gi|2235512... 79 5e-13 ref|XP_002270061.1| PREDICTED: SKP1-like protein 1B isoform 2 [V... 79 5e-13 ref|XP_006435227.1| hypothetical protein CICLE_v10002751mg [Citr... 79 7e-13 ref|XP_004512164.1| PREDICTED: SKP1-like protein 1A-like [Cicer ... 79 7e-13 ref|XP_003517160.1| PREDICTED: SKP1-like protein 1A-like [Glycin... 79 7e-13 gb|EPS66410.1| hypothetical protein M569_08366, partial [Genlise... 79 9e-13 gb|EXB60668.1| SKP1-like protein 1B [Morus notabilis] 78 1e-12 ref|XP_002305525.2| E3 ubiquitin ligase SCF complex subunit SKP1... 78 1e-12 ref|XP_007157884.1| hypothetical protein PHAVU_002G106100g [Phas... 78 1e-12 ref|XP_007202708.1| hypothetical protein PRUPE_ppa012752mg [Prun... 78 1e-12 >ref|XP_004144851.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus] gi|449508821|ref|XP_004163420.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus] Length = 155 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -1 Query: 131 SKKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 SKKI L+SSDGETFDVDE+VA+ESQTIKHMIEDDCAD+VIPLP Sbjct: 4 SKKIVLRSSDGETFDVDEIVAVESQTIKHMIEDDCADTVIPLP 46 >ref|XP_002531150.1| skp1, putative [Ricinus communis] gi|223529263|gb|EEF31235.1| skp1, putative [Ricinus communis] Length = 161 Score = 81.3 bits (199), Expect = 1e-13 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -1 Query: 131 SKKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 SKKITLKSSDGE F+VDEVVALESQTIKHMIEDDCADS IPLP Sbjct: 3 SKKITLKSSDGEPFEVDEVVALESQTIKHMIEDDCADSGIPLP 45 >ref|XP_007156190.1| hypothetical protein PHAVU_003G265900g [Phaseolus vulgaris] gi|561029544|gb|ESW28184.1| hypothetical protein PHAVU_003G265900g [Phaseolus vulgaris] Length = 155 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -1 Query: 131 SKKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 +KKITLKSSDGE F+VDE+VALESQTIKHMIEDDCADS IPLP Sbjct: 4 TKKITLKSSDGEAFEVDEIVALESQTIKHMIEDDCADSGIPLP 46 >ref|XP_006422586.1| hypothetical protein CICLE_v10029465mg [Citrus clementina] gi|568866779|ref|XP_006486726.1| PREDICTED: SKP1-like protein 1B-like [Citrus sinensis] gi|557524520|gb|ESR35826.1| hypothetical protein CICLE_v10029465mg [Citrus clementina] Length = 158 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -1 Query: 128 KKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 KKITLKSSDGETF+V+E VALESQTIKHM+EDDCAD+VIPLP Sbjct: 5 KKITLKSSDGETFEVEETVALESQTIKHMVEDDCADTVIPLP 46 >ref|XP_002537506.1| skp1, putative [Ricinus communis] gi|223516097|gb|EEF24877.1| skp1, putative [Ricinus communis] Length = 158 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -1 Query: 131 SKKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 SKKITLKSSDGETFDV+E VA+ESQTIKH+I+DDCADSVIP+P Sbjct: 4 SKKITLKSSDGETFDVEEAVAVESQTIKHIIDDDCADSVIPIP 46 >gb|AAD34458.1| Skp1 [Medicago sativa] Length = 153 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -1 Query: 131 SKKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 ++KITLKSSDGETF+VDE VALESQTIKHMIEDDCADS IPLP Sbjct: 2 TRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADSGIPLP 44 >ref|XP_002510576.1| skp1, putative [Ricinus communis] gi|223551277|gb|EEF52763.1| skp1, putative [Ricinus communis] Length = 157 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -1 Query: 131 SKKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 S+KITLKSSDGETF+VDE VALESQTIKHMIEDDCAD+ IPLP Sbjct: 4 SRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLP 46 >gb|ACJ86090.1| unknown [Medicago truncatula] Length = 155 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -1 Query: 131 SKKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 ++KITLKSSDGETF+VDE VALESQTIKHMIEDDCADS IPLP Sbjct: 4 TRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADSGIPLP 46 >ref|XP_003612225.1| SKP1-like protein [Medicago truncatula] gi|109255188|gb|ABG27019.1| SKP1-like a [Medicago truncatula] gi|217071242|gb|ACJ83981.1| unknown [Medicago truncatula] gi|355513560|gb|AES95183.1| SKP1-like protein [Medicago truncatula] gi|388519045|gb|AFK47584.1| unknown [Medicago truncatula] Length = 155 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -1 Query: 131 SKKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 ++KITLKSSDGETF+VDE VALESQTIKHMIEDDCADS IPLP Sbjct: 4 TRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADSGIPLP 46 >ref|XP_003612227.1| SKP1-like protein [Medicago truncatula] gi|109255190|gb|ABG27020.1| SKP1-like b [Medicago truncatula] gi|217071548|gb|ACJ84134.1| unknown [Medicago truncatula] gi|217075170|gb|ACJ85945.1| unknown [Medicago truncatula] gi|355513562|gb|AES95185.1| SKP1-like protein [Medicago truncatula] gi|388502012|gb|AFK39072.1| unknown [Medicago truncatula] Length = 155 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -1 Query: 131 SKKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 ++KITLKSSDGETF+VDE VALESQTIKHMIEDDCADS IPLP Sbjct: 4 TRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADSGIPLP 46 >ref|XP_002510577.1| skp1, putative [Ricinus communis] gi|223551278|gb|EEF52764.1| skp1, putative [Ricinus communis] Length = 157 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -1 Query: 128 KKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 KKITLKSSDGETF+V+E+VALESQTIKHMIEDDCADS IPLP Sbjct: 5 KKITLKSSDGETFEVEELVALESQTIKHMIEDDCADSGIPLP 46 >ref|XP_002270061.1| PREDICTED: SKP1-like protein 1B isoform 2 [Vitis vinifera] gi|147788379|emb|CAN76662.1| hypothetical protein VITISV_040452 [Vitis vinifera] Length = 156 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -1 Query: 131 SKKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 S+KITLKSSDGE FDVDE VALESQTIKHMIEDDCAD+ IPLP Sbjct: 4 SRKITLKSSDGEAFDVDEAVALESQTIKHMIEDDCADNGIPLP 46 >ref|XP_006435227.1| hypothetical protein CICLE_v10002751mg [Citrus clementina] gi|568839457|ref|XP_006473700.1| PREDICTED: SKP1-like protein 1B-like [Citrus sinensis] gi|557537349|gb|ESR48467.1| hypothetical protein CICLE_v10002751mg [Citrus clementina] Length = 158 Score = 79.0 bits (193), Expect = 7e-13 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -1 Query: 131 SKKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 SKKITLKSSDGE F+VDE VALESQTIKHMIEDDCAD+ IPLP Sbjct: 4 SKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADNGIPLP 46 >ref|XP_004512164.1| PREDICTED: SKP1-like protein 1A-like [Cicer arietinum] Length = 155 Score = 79.0 bits (193), Expect = 7e-13 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -1 Query: 131 SKKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 +KKITLKSSDGE F+VDE VALESQTIKHMIEDDCADS IPLP Sbjct: 4 TKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLP 46 >ref|XP_003517160.1| PREDICTED: SKP1-like protein 1A-like [Glycine max] Length = 155 Score = 79.0 bits (193), Expect = 7e-13 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -1 Query: 131 SKKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 +KKITLKSSDGE F+VDE VALESQTIKHMIEDDCADS IPLP Sbjct: 4 AKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLP 46 >gb|EPS66410.1| hypothetical protein M569_08366, partial [Genlisea aurea] Length = 168 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -1 Query: 131 SKKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 SKKITL+SSDGE F+V+E VA+ESQTIKHMIEDDCADSVIPLP Sbjct: 8 SKKITLRSSDGEIFEVEEAVAVESQTIKHMIEDDCADSVIPLP 50 >gb|EXB60668.1| SKP1-like protein 1B [Morus notabilis] Length = 157 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 128 KKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 +KITLKSSDGETF+VDE VALESQTIKHMIEDDCAD+ IPLP Sbjct: 5 RKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLP 46 >ref|XP_002305525.2| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein [Populus trichocarpa] gi|118481770|gb|ABK92824.1| unknown [Populus trichocarpa] gi|550341306|gb|EEE86036.2| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein [Populus trichocarpa] Length = 161 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -1 Query: 131 SKKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 SKKITLKSSDGETF VDE VA+ESQTIKHMIEDDCAD+ IPLP Sbjct: 4 SKKITLKSSDGETFVVDEAVAVESQTIKHMIEDDCADNEIPLP 46 >ref|XP_007157884.1| hypothetical protein PHAVU_002G106100g [Phaseolus vulgaris] gi|543176474|gb|AGV54260.1| SKP1-like protein [Phaseolus vulgaris] gi|561031299|gb|ESW29878.1| hypothetical protein PHAVU_002G106100g [Phaseolus vulgaris] Length = 155 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 131 SKKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 ++KITLKSSDGE F+VDE VALESQTIKHMIEDDCADS IPLP Sbjct: 4 ARKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLP 46 >ref|XP_007202708.1| hypothetical protein PRUPE_ppa012752mg [Prunus persica] gi|462398239|gb|EMJ03907.1| hypothetical protein PRUPE_ppa012752mg [Prunus persica] Length = 156 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -1 Query: 131 SKKITLKSSDGETFDVDEVVALESQTIKHMIEDDCADSVIPLP 3 SKKITLKSSDGE+F+V+E VALESQTIKHMIEDDCAD+ IPLP Sbjct: 5 SKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLP 47