BLASTX nr result
ID: Sinomenium22_contig00029181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00029181 (391 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514128.1| hypothetical protein RCOM_1047200 [Ricinus c... 61 2e-07 ref|XP_006853868.1| hypothetical protein AMTR_s00036p00121900 [A... 59 5e-07 ref|XP_002308280.2| hypothetical protein POPTR_0006s15030g [Popu... 56 5e-06 gb|EYU27322.1| hypothetical protein MIMGU_mgv1a014497mg [Mimulus... 56 6e-06 >ref|XP_002514128.1| hypothetical protein RCOM_1047200 [Ricinus communis] gi|223546584|gb|EEF48082.1| hypothetical protein RCOM_1047200 [Ricinus communis] Length = 229 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/51 (60%), Positives = 39/51 (76%), Gaps = 3/51 (5%) Frame = +3 Query: 3 ERAKEEVEALVEAIHPKKESTSHNSSP---KKGSGGPFASIGRRFEKICSP 146 +RAKEE+EA+VEAIHPKKE++ +SS K+ GG ASIGR EK+CSP Sbjct: 153 QRAKEEIEAIVEAIHPKKETSGFDSSSPLRKEEDGGLGASIGRGLEKVCSP 203 >ref|XP_006853868.1| hypothetical protein AMTR_s00036p00121900 [Amborella trichopoda] gi|548857536|gb|ERN15335.1| hypothetical protein AMTR_s00036p00121900 [Amborella trichopoda] Length = 115 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = +3 Query: 3 ERAKEEVEALVEAIHPKKESTSH-NSSPKKGSGGPFASIGRRFEKICSP 146 ERAKEE+EALV+ +HPKKE ++ P+K GG +A +G RFEK CSP Sbjct: 65 ERAKEEIEALVQTVHPKKEPINNPGGPPEKNRGGFWAFLGSRFEKFCSP 113 >ref|XP_002308280.2| hypothetical protein POPTR_0006s15030g [Populus trichocarpa] gi|550336376|gb|EEE91803.2| hypothetical protein POPTR_0006s15030g [Populus trichocarpa] Length = 239 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +3 Query: 3 ERAKEEVEALVEAIHPKKESTSHNSSPKKGSGGPFASIGRRFEKICS 143 +RAKEEVEALV+ IH KKES++ SSPKK GG A IG+ EKICS Sbjct: 186 QRAKEEVEALVQTIHRKKESSNSVSSPKK-EGGFGACIGKGLEKICS 231 >gb|EYU27322.1| hypothetical protein MIMGU_mgv1a014497mg [Mimulus guttatus] Length = 187 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = +3 Query: 3 ERAKEEVEALVEAIHPKKESTSHNSSPKKGSGGPFASIGRRFEKICSP 146 ERAKEE+EAL++ IHPKK+ S+PKK G AS+G+R EKICSP Sbjct: 140 ERAKEEIEALIQTIHPKKD-----SAPKK-EGSFSASVGKRLEKICSP 181