BLASTX nr result
ID: Sinomenium22_contig00029114
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00029114 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007134699.1| hypothetical protein PHAVU_010G068900g, part... 95 3e-22 gb|AHH30439.1| ribosomal protein S14 (chloroplast) [Bartsia inae... 109 3e-22 gb|EYU35341.1| hypothetical protein MIMGU_mgv11b016072mg [Mimulu... 107 1e-21 ref|YP_008994288.1| ribosomal protein S14 [Melianthus villosus] ... 107 1e-21 ref|YP_008963393.1| ribosomal protein S14 (chloroplast) [Sedum s... 107 1e-21 ref|YP_008963478.1| ribosomal protein S14 (chloroplast) [Penthor... 107 1e-21 ref|YP_008963603.1| ribosomal protein S14 (chloroplast) [Lupinus... 107 1e-21 ref|YP_008815935.1| ribosomal protein S14 (chloroplast) [Lindenb... 107 1e-21 ref|YP_008578171.1| ribosomal protein S14 (chloroplast) [Stockwe... 107 1e-21 ref|YP_008576216.1| ribosomal protein S14 (chloroplast) [Eucalyp... 107 1e-21 ref|YP_008082731.1| ribosomal protein S14 [Prinsepia utilis] gi|... 107 1e-21 ref|YP_008081363.1| ribosomal protein S14 (chloroplast) [Tetrace... 107 1e-21 ref|YP_007890306.1| ribosomal protein S14 (chloroplast) [Cistanc... 107 1e-21 ref|YP_007889859.1| ribosomal protein S14 [Francoa sonchifolia] ... 107 1e-21 ref|YP_007624793.1| chloroplast 30S ribosomal protein S14 (chlor... 107 1e-21 gb|AEX99512.1| ribosomal protein S14 (chloroplast) [Chrysanthemu... 107 1e-21 ref|YP_007353913.1| ribosomal protein S14 (chloroplast) [Tectona... 107 1e-21 ref|YP_007353764.1| ribosomal protein S14 (chloroplast) [Chrysan... 107 1e-21 ref|YP_007317246.1| ribosomal protein S14 (chloroplast) [Camelli... 107 1e-21 ref|YP_086964.1| ribosomal protein S14 [Panax ginseng] gi|359422... 107 1e-21 >ref|XP_007134699.1| hypothetical protein PHAVU_010G068900g, partial [Phaseolus vulgaris] gi|561007744|gb|ESW06693.1| hypothetical protein PHAVU_010G068900g, partial [Phaseolus vulgaris] Length = 84 Score = 95.1 bits (235), Expect(2) = 3e-22 Identities = 44/48 (91%), Positives = 44/48 (91%) Frame = +2 Query: 5 RNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSS 148 RNSAP RLHRRCFSTGR RANYRDFGLSGHIL EMVHAC LPGATRSS Sbjct: 4 RNSAPIRLHRRCFSTGRPRANYRDFGLSGHILEEMVHACFLPGATRSS 51 Score = 35.8 bits (81), Expect(2) = 3e-22 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = +1 Query: 214 PLPFCINGLFYFYRYGRGEHPILV 285 PLP INGLFY Y Y +G H I V Sbjct: 58 PLPLYINGLFYLYIYSKGMHSIFV 81 >gb|AHH30439.1| ribosomal protein S14 (chloroplast) [Bartsia inaequalis] Length = 100 Score = 109 bits (273), Expect = 3e-22 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 51 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >gb|EYU35341.1| hypothetical protein MIMGU_mgv11b016072mg [Mimulus guttatus] Length = 100 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 51 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|YP_008994288.1| ribosomal protein S14 [Melianthus villosus] gi|527355138|gb|AGS13007.1| ribosomal protein S14 [Melianthus villosus] Length = 100 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 51 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|YP_008963393.1| ribosomal protein S14 (chloroplast) [Sedum sarmentosum] gi|402797528|gb|AFQ99060.1| ribosomal protein S14 (chloroplast) [Sedum sarmentosum] Length = 100 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 51 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|YP_008963478.1| ribosomal protein S14 (chloroplast) [Penthorum chinense] gi|403226779|gb|AFR25658.1| ribosomal protein S14 (chloroplast) [Penthorum chinense] Length = 100 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 51 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|YP_008963603.1| ribosomal protein S14 (chloroplast) [Lupinus luteus] gi|485474314|gb|AGK82916.1| ribosomal protein S14 (chloroplast) [Lupinus luteus] Length = 100 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 51 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|YP_008815935.1| ribosomal protein S14 (chloroplast) [Lindenbergia philippensis] gi|557136861|emb|CDI43916.1| ribosomal protein S14 (chloroplast) [Lindenbergia philippensis] Length = 100 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 51 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|YP_008578171.1| ribosomal protein S14 (chloroplast) [Stockwellia quadrifida] gi|545719425|ref|YP_008578086.1| ribosomal protein S14 (chloroplast) [Allosyncarpia ternata] gi|442569333|gb|AGC59495.1| ribosomal protein S14 (chloroplast) [Allosyncarpia ternata] gi|442569419|gb|AGC59580.1| ribosomal protein S14 (chloroplast) [Stockwellia quadrifida] Length = 100 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 51 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|YP_008576216.1| ribosomal protein S14 (chloroplast) [Eucalyptus curtisii] gi|442567269|gb|AGC57455.1| ribosomal protein S14 (chloroplast) [Eucalyptus curtisii] Length = 100 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 51 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|YP_008082731.1| ribosomal protein S14 [Prinsepia utilis] gi|501418821|gb|AGL94698.1| ribosomal protein S14 [Prinsepia utilis] Length = 100 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 51 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|YP_008081363.1| ribosomal protein S14 (chloroplast) [Tetracentron sinense] gi|479279201|gb|AGJ72055.1| ribosomal protein S14 (chloroplast) [Tetracentron sinense] Length = 100 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 51 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|YP_007890306.1| ribosomal protein S14 (chloroplast) [Cistanche deserticola] gi|429537019|gb|AFZ99590.1| ribosomal protein S14 (chloroplast) [Cistanche deserticola] Length = 100 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 51 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|YP_007889859.1| ribosomal protein S14 [Francoa sonchifolia] gi|386268363|gb|AFJ00469.1| ribosomal protein S14 [Francoa sonchifolia] Length = 100 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 51 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|YP_007624793.1| chloroplast 30S ribosomal protein S14 (chloroplast) [Artemisia frigida] gi|401712194|gb|AFP98819.1| chloroplast 30S ribosomal protein S14 (chloroplast) [Artemisia frigida] Length = 100 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 51 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >gb|AEX99512.1| ribosomal protein S14 (chloroplast) [Chrysanthemum indicum] Length = 95 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 46 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 95 >ref|YP_007353913.1| ribosomal protein S14 (chloroplast) [Tectona grandis] gi|438687602|emb|CCP47128.1| ribosomal protein S14 (chloroplast) [Tectona grandis] gi|438688286|emb|CCP47217.1| ribosomal protein S14 (chloroplast) [Tectona grandis] gi|438688410|emb|CCP47306.1| ribosomal protein S14 (chloroplast) [Tectona grandis] Length = 100 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 51 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|YP_007353764.1| ribosomal protein S14 (chloroplast) [Chrysanthemum x morifolium] gi|452849049|ref|YP_007474727.1| ribosomal protein S14 (chloroplast) [Chrysanthemum indicum] gi|372863204|gb|AEX99276.1| ribosomal protein S14 (chloroplast) [Chrysanthemum indicum] gi|375298833|gb|AFA45272.1| ribosomal protein S14 (chloroplast) [Chrysanthemum x morifolium] Length = 95 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 46 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 95 >ref|YP_007317246.1| ribosomal protein S14 (chloroplast) [Camellia sinensis] gi|542688167|ref|YP_008520137.1| 30S ribosomal protein S14 (chloroplast) [Camellia taliensis] gi|552539641|ref|YP_008592755.1| 30S ribosomal protein S14 (chloroplast) [Camellia cuspidata] gi|552540890|ref|YP_008592844.1| 30S ribosomal protein S14 (chloroplast) [Camellia danzaiensis] gi|552540983|ref|YP_008592931.1| 30S ribosomal protein S14 (chloroplast) [Camellia impressinervis] gi|552541077|ref|YP_008593109.1| 30S ribosomal protein S14 (chloroplast) [Camellia yunnanensis] gi|552546236|ref|YP_008593020.1| 30S ribosomal protein S14 (chloroplast) [Camellia pitardii] gi|568244557|ref|YP_008963304.1| ribosomal protein S14 [Camellia oleifera] gi|388893205|gb|AFK81297.1| ribosomal protein S14 [Camellia sinensis var. assamica] gi|388893293|gb|AFK81384.1| ribosomal protein S14 [Camellia oleifera] gi|388893381|gb|AFK81471.1| ribosomal protein S14 [Camellia taliensis] gi|430728270|gb|AGA55594.1| ribosomal protein S14 (chloroplast) [Camellia sinensis] gi|537362459|gb|AGU44267.1| 30S ribosomal protein S14 (chloroplast) [Camellia cuspidata] gi|537362549|gb|AGU44356.1| 30S ribosomal protein S14 (chloroplast) [Camellia danzaiensis] gi|537362637|gb|AGU44443.1| 30S ribosomal protein S14 (chloroplast) [Camellia impressinervis] gi|537362727|gb|AGU44532.1| 30S ribosomal protein S14 (chloroplast) [Camellia taliensis] gi|537362817|gb|AGU44621.1| 30S ribosomal protein S14 (chloroplast) [Camellia pitardii] gi|537362907|gb|AGU44710.1| 30S ribosomal protein S14 (chloroplast) [Camellia yunnanensis] gi|537362997|gb|AGU44799.1| 30S ribosomal protein S14 (chloroplast) [Camellia taliensis] gi|555945914|gb|AGZ19141.1| ribosomal protein S14 (chloroplast) [Camellia sinensis] Length = 100 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 51 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100 >ref|YP_086964.1| ribosomal protein S14 [Panax ginseng] gi|359422142|ref|YP_004935550.1| ribosomal protein S14 (chloroplast) [Eleutherococcus senticosus] gi|558602910|ref|YP_008814941.1| ribosomal protein S14 (chloroplast) [Brassaiopsis hainla] gi|558602998|ref|YP_008815028.1| ribosomal protein S14 (chloroplast) [Metapanax delavayi] gi|558603086|ref|YP_008815115.1| ribosomal protein S14 (chloroplast) [Schefflera delavayi] gi|563940277|ref|YP_008814854.1| ribosomal protein S14 (chloroplast) [Aralia undulata] gi|75254106|sp|Q68S08.1|RR14_PANGI RecName: Full=30S ribosomal protein S14, chloroplastic gi|51235311|gb|AAT98507.1| ribosomal protein S14 [Panax ginseng] gi|347448205|gb|AEO92617.1| ribosomal protein S14 (chloroplast) [Eleutherococcus senticosus] gi|458599088|gb|AGG38954.1| ribosomal protein S14 (chloroplast) [Aralia undulata] gi|458599190|gb|AGG39041.1| ribosomal protein S14 (chloroplast) [Brassaiopsis hainla] gi|458599369|gb|AGG39128.1| ribosomal protein S14 (chloroplast) [Metapanax delavayi] gi|458599522|gb|AGG39215.1| ribosomal protein S14 (chloroplast) [Schefflera delavayi] gi|506444458|gb|AGM15020.1| ribosomal protein S14 (chloroplast) [Panax ginseng] gi|506444546|gb|AGM15106.1| ribosomal protein S14 (chloroplast) [Panax ginseng] gi|506444662|gb|AGM15192.1| ribosomal protein S14 (chloroplast) [Panax ginseng] Length = 100 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +2 Query: 2 PRNSAPTRLHRRCFSTGRSRANYRDFGLSGHILREMVHACLLPGATRSSW 151 PRNSAPTRLHRRCFSTGR RANYRDFGLSGHILREMVHACLLPGATRSSW Sbjct: 51 PRNSAPTRLHRRCFSTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW 100