BLASTX nr result
ID: Sinomenium22_contig00028925
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00028925 (1184 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77300.1| hypothetical protein VITISV_042537 [Vitis vinifera] 62 4e-07 >emb|CAN77300.1| hypothetical protein VITISV_042537 [Vitis vinifera] Length = 1435 Score = 62.4 bits (150), Expect = 4e-07 Identities = 29/55 (52%), Positives = 33/55 (60%) Frame = -2 Query: 856 VDWRVRQAEYIAMWDSRRGCIVRVDMRQGDVDYHDKYMCWYCSTTWGFMTGQAPF 692 VDW R A+YI W SRRG IVR +M G + YHD YM WY S T F+T F Sbjct: 1187 VDWTTRHADYIRRWSSRRGHIVRGEMDIGSLGYHDPYMVWYRSITIQFLTRTGSF 1241