BLASTX nr result
ID: Sinomenium22_contig00028722
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00028722 (443 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797... 123 2e-26 ref|NP_001241480.1| uncharacterized protein LOC100797411 [Glycin... 123 2e-26 gb|EXB62019.1| Peptidyl-prolyl cis-trans isomerase FKBP19 [Morus... 122 5e-26 gb|EPS63301.1| hypothetical protein M569_11486, partial [Genlise... 121 9e-26 ref|XP_007226020.1| hypothetical protein PRUPE_ppa010126mg [Prun... 121 9e-26 ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 121 1e-25 ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citr... 121 1e-25 ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citr... 121 1e-25 ref|XP_007043768.1| FKBP-like peptidyl-prolyl cis-trans isomeras... 120 1e-25 ref|XP_007043767.1| FKBP-like peptidyl-prolyl cis-trans isomeras... 120 1e-25 ref|XP_004491988.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 120 3e-25 ref|XP_002267989.1| PREDICTED: probable FKBP-type peptidyl-proly... 120 3e-25 ref|XP_002873610.1| immunophilin [Arabidopsis lyrata subsp. lyra... 119 4e-25 ref|XP_007139197.1| hypothetical protein PHAVU_008G009400g [Phas... 119 6e-25 ref|XP_006286545.1| hypothetical protein CARUB_v10001775mg [Caps... 119 6e-25 ref|XP_002512679.1| fk506-binding protein, putative [Ricinus com... 119 6e-25 ref|XP_006844451.1| hypothetical protein AMTR_s00016p00074550 [A... 118 7e-25 dbj|BAD42981.1| unknown protein [Arabidopsis thaliana] 118 7e-25 ref|NP_196845.1| putative FKBP-type peptidyl-prolyl cis-trans is... 118 7e-25 ref|XP_003621051.1| Peptidyl-prolyl cis-trans isomerase-like pro... 118 1e-24 >ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797411 isoform X1 [Glycine max] Length = 242 Score = 123 bits (309), Expect = 2e-26 Identities = 59/63 (93%), Positives = 62/63 (98%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 ALGGIRR+IVPPELGYPENDFNK+GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI Sbjct: 180 ALGGIRRIIVPPELGYPENDFNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 239 Query: 262 MSN 254 + N Sbjct: 240 IPN 242 >ref|NP_001241480.1| uncharacterized protein LOC100797411 [Glycine max] gi|255646496|gb|ACU23726.1| unknown [Glycine max] Length = 241 Score = 123 bits (309), Expect = 2e-26 Identities = 59/63 (93%), Positives = 62/63 (98%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 ALGGIRR+IVPPELGYPENDFNK+GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI Sbjct: 179 ALGGIRRIIVPPELGYPENDFNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 238 Query: 262 MSN 254 + N Sbjct: 239 IPN 241 >gb|EXB62019.1| Peptidyl-prolyl cis-trans isomerase FKBP19 [Morus notabilis] Length = 350 Score = 122 bits (306), Expect = 5e-26 Identities = 58/63 (92%), Positives = 62/63 (98%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 ALGGIRR+IVPPELGYPENDFNK+GPRPTTFSGQRALDFVL+NQGLIDKTLLFDIELLKI Sbjct: 288 ALGGIRRIIVPPELGYPENDFNKSGPRPTTFSGQRALDFVLKNQGLIDKTLLFDIELLKI 347 Query: 262 MSN 254 + N Sbjct: 348 IPN 350 >gb|EPS63301.1| hypothetical protein M569_11486, partial [Genlisea aurea] Length = 196 Score = 121 bits (304), Expect = 9e-26 Identities = 57/63 (90%), Positives = 61/63 (96%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 A+GG+RR+IVPPELGYPENDFNK GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI Sbjct: 131 AVGGVRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 190 Query: 262 MSN 254 + N Sbjct: 191 LPN 193 >ref|XP_007226020.1| hypothetical protein PRUPE_ppa010126mg [Prunus persica] gi|462422956|gb|EMJ27219.1| hypothetical protein PRUPE_ppa010126mg [Prunus persica] Length = 262 Score = 121 bits (304), Expect = 9e-26 Identities = 57/63 (90%), Positives = 62/63 (98%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 ALGGIRR+IVPPELGYPEND+NK+GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIEL+KI Sbjct: 200 ALGGIRRIIVPPELGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELIKI 259 Query: 262 MSN 254 + N Sbjct: 260 IPN 262 >ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like isoform X1 [Citrus sinensis] Length = 267 Score = 121 bits (303), Expect = 1e-25 Identities = 56/63 (88%), Positives = 62/63 (98%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 ALGG+RR+IVPPE+GYPEND+NK+GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI Sbjct: 205 ALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 264 Query: 262 MSN 254 + N Sbjct: 265 IPN 267 >ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522685|gb|ESR34052.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 250 Score = 121 bits (303), Expect = 1e-25 Identities = 56/63 (88%), Positives = 62/63 (98%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 ALGG+RR+IVPPE+GYPEND+NK+GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI Sbjct: 188 ALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 247 Query: 262 MSN 254 + N Sbjct: 248 IPN 250 >ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|567855379|ref|XP_006420809.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522681|gb|ESR34048.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522682|gb|ESR34049.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 267 Score = 121 bits (303), Expect = 1e-25 Identities = 56/63 (88%), Positives = 62/63 (98%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 ALGG+RR+IVPPE+GYPEND+NK+GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI Sbjct: 205 ALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 264 Query: 262 MSN 254 + N Sbjct: 265 IPN 267 >ref|XP_007043768.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Theobroma cacao] gi|508707703|gb|EOX99599.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Theobroma cacao] Length = 255 Score = 120 bits (302), Expect = 1e-25 Identities = 58/63 (92%), Positives = 61/63 (96%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 ALGGIRR+IVPPELGYP NDFNK+GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI Sbjct: 193 ALGGIRRIIVPPELGYPGNDFNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 252 Query: 262 MSN 254 + N Sbjct: 253 IPN 255 >ref|XP_007043767.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Theobroma cacao] gi|508707702|gb|EOX99598.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Theobroma cacao] Length = 249 Score = 120 bits (302), Expect = 1e-25 Identities = 58/63 (92%), Positives = 61/63 (96%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 ALGGIRR+IVPPELGYP NDFNK+GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI Sbjct: 187 ALGGIRRIIVPPELGYPGNDFNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 246 Query: 262 MSN 254 + N Sbjct: 247 IPN 249 >ref|XP_004491988.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Cicer arietinum] Length = 240 Score = 120 bits (300), Expect = 3e-25 Identities = 55/63 (87%), Positives = 62/63 (98%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 +LGG+RR+IVPPELGYPEND+NK+GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIEL+KI Sbjct: 178 SLGGVRRIIVPPELGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELMKI 237 Query: 262 MSN 254 + N Sbjct: 238 IPN 240 >ref|XP_002267989.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 7, chloroplastic isoform 1 [Vitis vinifera] gi|296085536|emb|CBI29268.3| unnamed protein product [Vitis vinifera] Length = 257 Score = 120 bits (300), Expect = 3e-25 Identities = 57/63 (90%), Positives = 61/63 (96%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 +LG IRR+IVPPELGYPENDFNK+GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI Sbjct: 195 SLGSIRRIIVPPELGYPENDFNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 254 Query: 262 MSN 254 + N Sbjct: 255 IPN 257 >ref|XP_002873610.1| immunophilin [Arabidopsis lyrata subsp. lyrata] gi|297319447|gb|EFH49869.1| immunophilin [Arabidopsis lyrata subsp. lyrata] Length = 256 Score = 119 bits (298), Expect = 4e-25 Identities = 56/63 (88%), Positives = 61/63 (96%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 ALGGIRRLIVPPELGYP+ND+NK+GPRP TFSGQRALDFVLRNQGLIDKTLLFD+ELLKI Sbjct: 194 ALGGIRRLIVPPELGYPDNDYNKSGPRPMTFSGQRALDFVLRNQGLIDKTLLFDVELLKI 253 Query: 262 MSN 254 + N Sbjct: 254 VPN 256 >ref|XP_007139197.1| hypothetical protein PHAVU_008G009400g [Phaseolus vulgaris] gi|561012330|gb|ESW11191.1| hypothetical protein PHAVU_008G009400g [Phaseolus vulgaris] Length = 274 Score = 119 bits (297), Expect = 6e-25 Identities = 56/63 (88%), Positives = 60/63 (95%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 ALGGIRR+IVPPE+GYPENDFN+ PRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI Sbjct: 212 ALGGIRRIIVPPEIGYPENDFNRGAPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 271 Query: 262 MSN 254 + N Sbjct: 272 VPN 274 >ref|XP_006286545.1| hypothetical protein CARUB_v10001775mg [Capsella rubella] gi|482555251|gb|EOA19443.1| hypothetical protein CARUB_v10001775mg [Capsella rubella] Length = 256 Score = 119 bits (297), Expect = 6e-25 Identities = 55/63 (87%), Positives = 61/63 (96%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 ALGGIRR+IVPPELGYP+ND+NK+GPRP TFSGQRALDFVLRNQGLIDKTLLFD+ELLKI Sbjct: 194 ALGGIRRIIVPPELGYPDNDYNKSGPRPMTFSGQRALDFVLRNQGLIDKTLLFDVELLKI 253 Query: 262 MSN 254 + N Sbjct: 254 VQN 256 >ref|XP_002512679.1| fk506-binding protein, putative [Ricinus communis] gi|223548640|gb|EEF50131.1| fk506-binding protein, putative [Ricinus communis] Length = 246 Score = 119 bits (297), Expect = 6e-25 Identities = 55/60 (91%), Positives = 60/60 (100%) Frame = -2 Query: 439 LGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIM 260 LGG+RR+IVPPELGYPENDFN++GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+ Sbjct: 185 LGGVRRIIVPPELGYPENDFNRSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIL 244 >ref|XP_006844451.1| hypothetical protein AMTR_s00016p00074550 [Amborella trichopoda] gi|548846922|gb|ERN06126.1| hypothetical protein AMTR_s00016p00074550 [Amborella trichopoda] Length = 188 Score = 118 bits (296), Expect = 7e-25 Identities = 54/61 (88%), Positives = 61/61 (100%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 +LGG+RR+IVPPELGYP+NDFNK+GPRPTTFSGQRALDFVL+NQGLIDKTLLFDIEL+KI Sbjct: 126 SLGGVRRIIVPPELGYPDNDFNKSGPRPTTFSGQRALDFVLKNQGLIDKTLLFDIELIKI 185 Query: 262 M 260 M Sbjct: 186 M 186 >dbj|BAD42981.1| unknown protein [Arabidopsis thaliana] Length = 255 Score = 118 bits (296), Expect = 7e-25 Identities = 55/63 (87%), Positives = 61/63 (96%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 ALGGIRR+IVPPELGYP+ND+NK+GPRP TFSGQRALDFVLRNQGLIDKTLLFD+ELLKI Sbjct: 193 ALGGIRRIIVPPELGYPDNDYNKSGPRPMTFSGQRALDFVLRNQGLIDKTLLFDVELLKI 252 Query: 262 MSN 254 + N Sbjct: 253 VPN 255 >ref|NP_196845.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase 7 [Arabidopsis thaliana] gi|75335665|sp|Q9LYR5.1|FKB19_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic; Short=PPIase FKBP19; AltName: Full=FK506-binding protein 19; Short=AtFKBP19; AltName: Full=Immunophilin FKBP19; AltName: Full=Rotamase; Flags: Precursor gi|7543908|emb|CAB87148.1| putative protein [Arabidopsis thaliana] gi|46931302|gb|AAT06455.1| At5g13410 [Arabidopsis thaliana] gi|222423171|dbj|BAH19563.1| AT5G13410 [Arabidopsis thaliana] gi|332004508|gb|AED91891.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase 7 [Arabidopsis thaliana] Length = 256 Score = 118 bits (296), Expect = 7e-25 Identities = 55/63 (87%), Positives = 61/63 (96%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 ALGGIRR+IVPPELGYP+ND+NK+GPRP TFSGQRALDFVLRNQGLIDKTLLFD+ELLKI Sbjct: 194 ALGGIRRIIVPPELGYPDNDYNKSGPRPMTFSGQRALDFVLRNQGLIDKTLLFDVELLKI 253 Query: 262 MSN 254 + N Sbjct: 254 VPN 256 >ref|XP_003621051.1| Peptidyl-prolyl cis-trans isomerase-like protein [Medicago truncatula] gi|355496066|gb|AES77269.1| Peptidyl-prolyl cis-trans isomerase-like protein [Medicago truncatula] gi|388505130|gb|AFK40631.1| unknown [Medicago truncatula] Length = 240 Score = 118 bits (295), Expect = 1e-24 Identities = 55/63 (87%), Positives = 61/63 (96%) Frame = -2 Query: 442 ALGGIRRLIVPPELGYPENDFNKAGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI 263 +LGGIRR+IVPPELGYPE+D+NK GPRPTTFSGQRALDFVLRNQGLIDKTLLFDIEL+KI Sbjct: 178 SLGGIRRIIVPPELGYPESDYNKGGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELMKI 237 Query: 262 MSN 254 + N Sbjct: 238 VPN 240