BLASTX nr result
ID: Sinomenium22_contig00028577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00028577 (502 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845037.1| hypothetical protein AMTR_s00058p00219700 [A... 70 4e-10 >ref|XP_006845037.1| hypothetical protein AMTR_s00058p00219700 [Amborella trichopoda] gi|548847528|gb|ERN06712.1| hypothetical protein AMTR_s00058p00219700 [Amborella trichopoda] Length = 286 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/58 (60%), Positives = 44/58 (75%) Frame = -2 Query: 174 DSKSEFQRDMRKLVDLLSKLNPSAKEFVPSSYFPNPQSAVVSDSHKNLNNDDPFNNRR 1 DSKSEF RDMR+LVDLLSKLNPSA+EF PSS S ++D++++L ND N+RR Sbjct: 17 DSKSEFNRDMRELVDLLSKLNPSAEEFFPSSVTNRQYSNDLNDNNEDLGNDGSMNHRR 74