BLASTX nr result
ID: Sinomenium22_contig00028404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00028404 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006858584.1| hypothetical protein AMTR_s00071p00188270 [A... 61 1e-07 >ref|XP_006858584.1| hypothetical protein AMTR_s00071p00188270 [Amborella trichopoda] gi|548862693|gb|ERN20051.1| hypothetical protein AMTR_s00071p00188270 [Amborella trichopoda] Length = 599 Score = 61.2 bits (147), Expect = 1e-07 Identities = 34/73 (46%), Positives = 43/73 (58%) Frame = -3 Query: 223 TKSSYPSGKSRNLYTAVQNSRIGRGGSSSVYDLPLSLEDVKVDMSNSSRCGEVKTVGRSR 44 + +S GKSR NSR GRG SSS + L+ D K D S++SR E+KT G R Sbjct: 478 SNASSSMGKSRTSDLGYHNSRSGRGASSSSSEHSLNQGDTKFDTSSASRSLEMKTQGTGR 537 Query: 43 NSLSPIENGSHRH 5 +S +ENGSHRH Sbjct: 538 SSTVSVENGSHRH 550