BLASTX nr result
ID: Sinomenium22_contig00028393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00028393 (283 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006828389.1| hypothetical protein AMTR_s00060p00019070, p... 65 1e-08 emb|CAJ70646.1| cytochrome c biogenesis protein [Helianthus annuus] 58 2e-06 >ref|XP_006828389.1| hypothetical protein AMTR_s00060p00019070, partial [Amborella trichopoda] gi|548833137|gb|ERM95805.1| hypothetical protein AMTR_s00060p00019070, partial [Amborella trichopoda] Length = 326 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -3 Query: 212 KQNGFMFLYRLVIPLRSYLLLQFRSRLFHKIEWSGSHSIRLFSKNVEP 69 K+NGFMFL+RLVIPLRSYLLL F SRL HKIEW SH I L +V P Sbjct: 174 KKNGFMFLHRLVIPLRSYLLLLFLSRLVHKIEWP-SHPIVLVQSSVGP 220 >emb|CAJ70646.1| cytochrome c biogenesis protein [Helianthus annuus] Length = 206 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/54 (59%), Positives = 33/54 (61%) Frame = -3 Query: 281 GTACKIXXXXXXXXXXXXXXXXLKQNGFMFLYRLVIPLRSYLLLQFRSRLFHKI 120 GTA KI LKQNGFMF +RLVIP RSYL LQFRSRL HKI Sbjct: 153 GTARKIQPLHLLHCPQPFLVPLLKQNGFMFFHRLVIPFRSYLFLQFRSRLVHKI 206