BLASTX nr result
ID: Sinomenium22_contig00028289
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00028289 (497 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007043551.1| AP2/ERF domain-containing transcription fact... 80 3e-13 ref|XP_002267468.1| PREDICTED: ethylene-responsive transcription... 77 3e-12 ref|XP_006447343.1| hypothetical protein CICLE_v10015144mg [Citr... 73 4e-11 gb|AFV60736.1| ethylene-responsive transcription factor 4 [Caric... 73 4e-11 ref|XP_006371578.1| hypothetical protein POPTR_0019s13330g [Popu... 71 2e-10 ref|XP_002319909.2| hypothetical protein POPTR_0013s13920g [Popu... 69 9e-10 gb|ABQ62985.1| RAP2-like protein [Populus trichocarpa] 69 9e-10 ref|XP_002517949.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 ref|XP_004140031.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-res... 67 3e-09 ref|XP_004136820.1| PREDICTED: ethylene-responsive transcription... 67 3e-09 ref|XP_004243339.1| PREDICTED: ethylene-responsive transcription... 66 6e-09 ref|XP_006357496.1| PREDICTED: ethylene-responsive transcription... 65 7e-09 ref|XP_004166373.1| PREDICTED: ethylene-responsive transcription... 65 1e-08 ref|XP_007216848.1| hypothetical protein PRUPE_ppa021711mg [Prun... 63 4e-08 gb|EYU26148.1| hypothetical protein MIMGU_mgv11b016405mg, partia... 62 6e-08 ref|XP_007149866.1| hypothetical protein PHAVU_005G105200g [Phas... 62 8e-08 ref|XP_004487298.1| PREDICTED: ethylene-responsive transcription... 62 8e-08 ref|XP_003540897.1| PREDICTED: ethylene-responsive transcription... 61 1e-07 ref|XP_007132714.1| hypothetical protein PHAVU_011G118600g [Phas... 59 5e-07 emb|CCF23313.1| drought responsive element binding protein 5 [Gl... 59 5e-07 >ref|XP_007043551.1| AP2/ERF domain-containing transcription factor, putative [Theobroma cacao] gi|508707486|gb|EOX99382.1| AP2/ERF domain-containing transcription factor, putative [Theobroma cacao] Length = 484 Score = 80.1 bits (196), Expect = 3e-13 Identities = 44/88 (50%), Positives = 51/88 (57%), Gaps = 10/88 (11%) Frame = +3 Query: 21 LQADNVEIKQMALDSPVDDDLEKPNLLLGSSEVTASV----------TEEDVSGSSELVW 170 L + +I+ M + D + LGSSE TAS E VSGS ELVW Sbjct: 347 LNLQSAKIEMMPPPAQPQGDNPDSDSGLGSSEATASDEVQMTAEGSGAGEGVSGSQELVW 406 Query: 171 GNMEEAWFNSNPAGWGPGSSVWDDLDTT 254 G+M EAWFN+ PAGWGPGS VWDDLDTT Sbjct: 407 GDMAEAWFNAIPAGWGPGSPVWDDLDTT 434 >ref|XP_002267468.1| PREDICTED: ethylene-responsive transcription factor ERF054-like [Vitis vinifera] Length = 465 Score = 76.6 bits (187), Expect = 3e-12 Identities = 46/93 (49%), Positives = 52/93 (55%), Gaps = 9/93 (9%) Frame = +3 Query: 3 APTGQILQADNVEIKQMALDSPVDDDLEKPNLLLGSSEVTASVTE--------EDVSGSS 158 AP G LQ V + SP D + L+LGSSE A E E VS S Sbjct: 315 APEGLNLQDSEVGMLPPPAPSPGYDSNNELGLVLGSSEAAARNDEVQKSSNAGESVSESP 374 Query: 159 -ELVWGNMEEAWFNSNPAGWGPGSSVWDDLDTT 254 E VWG M EAWFN+ PAGWGPGS+VWDDLDT+ Sbjct: 375 PESVWGEMAEAWFNAIPAGWGPGSAVWDDLDTS 407 >ref|XP_006447343.1| hypothetical protein CICLE_v10015144mg [Citrus clementina] gi|568877222|ref|XP_006491642.1| PREDICTED: ethylene-responsive transcription factor ERF053-like [Citrus sinensis] gi|557549954|gb|ESR60583.1| hypothetical protein CICLE_v10015144mg [Citrus clementina] Length = 466 Score = 73.2 bits (178), Expect = 4e-11 Identities = 36/61 (59%), Positives = 40/61 (65%), Gaps = 10/61 (16%) Frame = +3 Query: 102 LGSSEVTASV----------TEEDVSGSSELVWGNMEEAWFNSNPAGWGPGSSVWDDLDT 251 LGSSE TAS + E VSGS EL WG M EAWFN+ PAGWGPGS VWDD D+ Sbjct: 347 LGSSEATASDDVLAAAEGSGSGEGVSGSQELAWGEMAEAWFNAIPAGWGPGSPVWDDFDS 406 Query: 252 T 254 + Sbjct: 407 S 407 >gb|AFV60736.1| ethylene-responsive transcription factor 4 [Carica papaya] Length = 430 Score = 73.2 bits (178), Expect = 4e-11 Identities = 41/88 (46%), Positives = 50/88 (56%), Gaps = 5/88 (5%) Frame = +3 Query: 6 PTGQILQADNVEIKQMALDSPVDDDLEKPNLLLGSSEVTASVTEEDVSGSS-----ELVW 170 PT QI + + P +D + +GSSE TA+ ++V GS EL W Sbjct: 292 PTLQISTTETMPPPPPPPPPPPQEDNPDSDSGIGSSEATAN---DEVQGSGAGDNQELAW 348 Query: 171 GNMEEAWFNSNPAGWGPGSSVWDDLDTT 254 G + EAWFNS PAGWGPGS VWDDLDTT Sbjct: 349 GAVAEAWFNSIPAGWGPGSPVWDDLDTT 376 >ref|XP_006371578.1| hypothetical protein POPTR_0019s13330g [Populus trichocarpa] gi|550317457|gb|ERP49375.1| hypothetical protein POPTR_0019s13330g [Populus trichocarpa] Length = 464 Score = 70.9 bits (172), Expect = 2e-10 Identities = 37/67 (55%), Positives = 42/67 (62%), Gaps = 2/67 (2%) Frame = +3 Query: 60 DSPVDDDLEKPNLLLGSSEVTA--SVTEEDVSGSSELVWGNMEEAWFNSNPAGWGPGSSV 233 D P DD + S EV A S E SGS EL+WG+M EAW+N+ AGWGPGS V Sbjct: 344 DHPDDDSGLGSSGATVSDEVQAVGSSAGEGTSGSQELMWGDMAEAWYNAIQAGWGPGSPV 403 Query: 234 WDDLDTT 254 WDDLDTT Sbjct: 404 WDDLDTT 410 >ref|XP_002319909.2| hypothetical protein POPTR_0013s13920g [Populus trichocarpa] gi|550325808|gb|EEE95832.2| hypothetical protein POPTR_0013s13920g [Populus trichocarpa] Length = 469 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/69 (50%), Positives = 42/69 (60%), Gaps = 4/69 (5%) Frame = +3 Query: 60 DSPVDDDLEKPNLLLGSSEVTA----SVTEEDVSGSSELVWGNMEEAWFNSNPAGWGPGS 227 D P DD + S E+ A S E +SGS EL WG+M EAW+N+ AGWGPGS Sbjct: 349 DHPDDDSGMGSSGATVSDEIQAVAEGSSAGEGISGSQELEWGDMAEAWYNAIQAGWGPGS 408 Query: 228 SVWDDLDTT 254 VWDDLD+T Sbjct: 409 PVWDDLDST 417 >gb|ABQ62985.1| RAP2-like protein [Populus trichocarpa] Length = 469 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/69 (50%), Positives = 42/69 (60%), Gaps = 4/69 (5%) Frame = +3 Query: 60 DSPVDDDLEKPNLLLGSSEVTA----SVTEEDVSGSSELVWGNMEEAWFNSNPAGWGPGS 227 D P DD + S E+ A S E +SGS EL WG+M EAW+N+ AGWGPGS Sbjct: 349 DHPDDDSGMGSSGATVSDEIQAVAEGSSAGEGISGSQELEWGDMAEAWYNAIQAGWGPGS 408 Query: 228 SVWDDLDTT 254 VWDDLD+T Sbjct: 409 PVWDDLDST 417 >ref|XP_002517949.1| conserved hypothetical protein [Ricinus communis] gi|223542931|gb|EEF44467.1| conserved hypothetical protein [Ricinus communis] Length = 426 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/39 (79%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = +3 Query: 138 EDVSGSSELVWGNM-EEAWFNSNPAGWGPGSSVWDDLDT 251 E VSGS ELVWG+M EAWFNS AGWGPGS VWDDLDT Sbjct: 345 EGVSGSQELVWGDMMTEAWFNSISAGWGPGSPVWDDLDT 383 >ref|XP_004140031.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription factor ERF054-like [Cucumis sativus] Length = 386 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +3 Query: 135 EEDVSGSSELVWGNMEEAWFNSNPAGWGPGSSVWDDLDTT 254 EE +S + E+VW M EAW N+ PAGWGPGS VWDDLDTT Sbjct: 304 EEGISKTQEMVWREMAEAWLNAMPAGWGPGSPVWDDLDTT 343 >ref|XP_004136820.1| PREDICTED: ethylene-responsive transcription factor ERF053-like [Cucumis sativus] gi|449522996|ref|XP_004168511.1| PREDICTED: ethylene-responsive transcription factor ERF053-like [Cucumis sativus] Length = 397 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/57 (57%), Positives = 38/57 (66%) Frame = +3 Query: 84 EKPNLLLGSSEVTASVTEEDVSGSSELVWGNMEEAWFNSNPAGWGPGSSVWDDLDTT 254 EKPN L S AS +E+VWG MEEAWFN+ PAGWGPGS+VWD+LD T Sbjct: 295 EKPNNDLTESGSCASEP-------TEMVWGEMEEAWFNAIPAGWGPGSAVWDNLDPT 344 >ref|XP_004243339.1| PREDICTED: ethylene-responsive transcription factor ERF054-like [Solanum lycopersicum] Length = 390 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/62 (54%), Positives = 41/62 (66%) Frame = +3 Query: 66 PVDDDLEKPNLLLGSSEVTASVTEEDVSGSSELVWGNMEEAWFNSNPAGWGPGSSVWDDL 245 P + D + +GSS+VT + S SSELVWG+M EAWFN+ GWGPGS VWDDL Sbjct: 291 PPEGDNHDEDSGIGSSQVTTN------SQSSELVWGDMAEAWFNAT--GWGPGSPVWDDL 342 Query: 246 DT 251 DT Sbjct: 343 DT 344 >ref|XP_006357496.1| PREDICTED: ethylene-responsive transcription factor ERF054-like [Solanum tuberosum] Length = 389 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/62 (54%), Positives = 41/62 (66%) Frame = +3 Query: 66 PVDDDLEKPNLLLGSSEVTASVTEEDVSGSSELVWGNMEEAWFNSNPAGWGPGSSVWDDL 245 P + D + +GSSEVT + S SSELVWG+M EAWFN+ GWGPGS VWDDL Sbjct: 290 PPEGDNHDKDSGIGSSEVTTN------SQSSELVWGDMAEAWFNAT--GWGPGSPVWDDL 341 Query: 246 DT 251 D+ Sbjct: 342 DS 343 >ref|XP_004166373.1| PREDICTED: ethylene-responsive transcription factor ERF054-like [Cucumis sativus] Length = 332 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/65 (52%), Positives = 39/65 (60%), Gaps = 7/65 (10%) Frame = +3 Query: 81 LEKPNLLLGSSEVTASVTEEDVSGSS-------ELVWGNMEEAWFNSNPAGWGPGSSVWD 239 L P LLL + A EE+ S +S E+VW M EAW N+ PAGWGPGS VWD Sbjct: 226 LNFPELLLNKDK-EAEEEEEEASQASAPQQDTQEMVWREMAEAWLNAMPAGWGPGSPVWD 284 Query: 240 DLDTT 254 DLDTT Sbjct: 285 DLDTT 289 >ref|XP_007216848.1| hypothetical protein PRUPE_ppa021711mg [Prunus persica] gi|462412998|gb|EMJ18047.1| hypothetical protein PRUPE_ppa021711mg [Prunus persica] Length = 461 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +3 Query: 147 SGSSELVWGNMEEAWFNSNPAGWGPGSSVWDDLDT 251 S ELVWG+M EAW N+ PAGWGPGS VWDDLDT Sbjct: 372 SQPEELVWGDMAEAWMNAIPAGWGPGSPVWDDLDT 406 >gb|EYU26148.1| hypothetical protein MIMGU_mgv11b016405mg, partial [Mimulus guttatus] Length = 526 Score = 62.4 bits (150), Expect = 6e-08 Identities = 35/88 (39%), Positives = 46/88 (52%), Gaps = 6/88 (6%) Frame = +3 Query: 3 APTGQILQADNVEIKQMALDS---PVDDDLEKPNLLLGSSEVT---ASVTEEDVSGSSEL 164 +PTG +L+ + A +S P + E G + T E+ SSEL Sbjct: 383 SPTGPVLELEPEPEPAPAQESVGLPAKNPEENSGFWSGETTETDYQIQANAENYDPSSEL 442 Query: 165 VWGNMEEAWFNSNPAGWGPGSSVWDDLD 248 VWG+ E WF+S PAGWGPGSSVWD+ D Sbjct: 443 VWGDTGEDWFDSIPAGWGPGSSVWDNFD 470 >ref|XP_007149866.1| hypothetical protein PHAVU_005G105200g [Phaseolus vulgaris] gi|561023130|gb|ESW21860.1| hypothetical protein PHAVU_005G105200g [Phaseolus vulgaris] Length = 407 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/49 (59%), Positives = 33/49 (67%) Frame = +3 Query: 108 SSEVTASVTEEDVSGSSELVWGNMEEAWFNSNPAGWGPGSSVWDDLDTT 254 + EV A+ E S ELVWG M AWFN+ PA WGPGS VWDDLD+T Sbjct: 321 TDEVHAAAAEGGEGVSQELVWGEMS-AWFNAIPAAWGPGSPVWDDLDST 368 >ref|XP_004487298.1| PREDICTED: ethylene-responsive transcription factor ERF053-like [Cicer arietinum] Length = 427 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = +3 Query: 102 LGSSEVTASVTEEDVSGSSELVWGNMEEAWFNSNPAGWGPGSSVWDDLD 248 +GSS+ AS ++VS S ELVW M AWFN+ PA WGPGS VWDDLD Sbjct: 337 IGSSDAAAS---DEVSQSQELVWSEMS-AWFNAIPAAWGPGSPVWDDLD 381 >ref|XP_003540897.1| PREDICTED: ethylene-responsive transcription factor ERF053-like [Glycine max] Length = 406 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/44 (63%), Positives = 31/44 (70%) Frame = +3 Query: 117 VTASVTEEDVSGSSELVWGNMEEAWFNSNPAGWGPGSSVWDDLD 248 V +VTEE +S ELVWG WFN+ PAGWGPGS VWDDLD Sbjct: 315 VENAVTEEGISQPQELVWGE----WFNAIPAGWGPGSPVWDDLD 354 >ref|XP_007132714.1| hypothetical protein PHAVU_011G118600g [Phaseolus vulgaris] gi|561005714|gb|ESW04708.1| hypothetical protein PHAVU_011G118600g [Phaseolus vulgaris] Length = 416 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = +3 Query: 132 TEEDVSGSSELVWGNMEEAWFNSNPAGWGPGSSVWDDLD 248 TEE VS ELVWG WFN+ PAGWGPGS VWDDLD Sbjct: 329 TEEGVSQPQELVWGE----WFNTIPAGWGPGSPVWDDLD 363 >emb|CCF23313.1| drought responsive element binding protein 5 [Glycine max] Length = 307 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/66 (45%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Frame = +3 Query: 60 DSPVDDDLEKPNLLLGSSEVTASVTEEDVSG-SSELVWGNMEEAWFNSNPAGWGPGSSVW 236 D P+++ E + S+ T E G S E+VWG M AWFN+ PA WGPGS +W Sbjct: 204 DVPIEESNENDSGDATVSDDQVHATTESSEGVSQEMVWGEMS-AWFNAIPAAWGPGSPMW 262 Query: 237 DDLDTT 254 DDLD T Sbjct: 263 DDLDAT 268