BLASTX nr result
ID: Sinomenium22_contig00028252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00028252 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006833080.1| hypothetical protein AMTR_s01648p00004570, p... 57 2e-06 >ref|XP_006833080.1| hypothetical protein AMTR_s01648p00004570, partial [Amborella trichopoda] gi|548837694|gb|ERM98358.1| hypothetical protein AMTR_s01648p00004570, partial [Amborella trichopoda] Length = 67 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = +1 Query: 1 VEEHVVXXXXXXXXXXXXXSKGGGAPANGQGKPKRGRTAPRDGKR 135 VEEHV SKG G PANGQGKPK+GR+APRDGKR Sbjct: 3 VEEHVAGRDDGRGDYGFGRSKGSGTPANGQGKPKKGRSAPRDGKR 47