BLASTX nr result
ID: Sinomenium22_contig00028152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00028152 (422 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006489358.1| PREDICTED: chloride channel protein CLC-d-li... 59 9e-07 ref|XP_002517213.1| chloride channel clc, putative [Ricinus comm... 56 6e-06 >ref|XP_006489358.1| PREDICTED: chloride channel protein CLC-d-like isoform X1 [Citrus sinensis] Length = 799 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 420 ENEDSTTVELQSSSVRATWGDNSLITRNSDVERPLLNGLLVQ 295 + EDSTTVELQS+SVRA D SL+TRN++ E PLLNGLLV+ Sbjct: 755 DGEDSTTVELQSTSVRAQRRDKSLLTRNTEAELPLLNGLLVE 796 >ref|XP_002517213.1| chloride channel clc, putative [Ricinus communis] gi|223543848|gb|EEF45376.1| chloride channel clc, putative [Ricinus communis] Length = 794 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -3 Query: 420 ENEDSTTVELQSSSVRATWGDNSLITRNSDVERPLLNGLLVQ 295 ++EDS +ELQS+SVR D + TRN+DVERPLLNGLLVQ Sbjct: 748 DHEDSANMELQSTSVRTHHQDKRMFTRNTDVERPLLNGLLVQ 789